KEGG   Citrus sinensis (Valencia orange): 102629721Help
Entry
102629721         CDS       T02983                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102629721
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     102629721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 NAD_binding_8 EF-hand_7 p25-alpha EF-hand_8 DUF1858 NAD_binding_7 PSI_PsaH
Motif
Other DBs
NCBI-GeneID: 102629721
NCBI-ProteinID: XP_006467902
UniProt: A0A067GAS2
Position
2
AA seq 583 aa AA seqDB search
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK
VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV
RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT
PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA
ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM
VVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWL
RVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQV
ELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQG
KYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVS
IGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggctatacgttctacgaaagagtttcgagagctttccatgattattcttcactt
tctaagttgattgtgatttccaccgtcggtggcggcagccttattgcttattctgaggca
aatgcatccagtgatgcatattctgttgctccacctgagatgggaattaagaaaaagaag
gttgtggtgcttggcactggctgggccggaacaagtttcttgaagaatctcaacaatccc
tcgtatgatgttcaagtgatatcacctcgtaattactttgcatttacccctttgcttccc
agtgttacttgtggcactgtggaagctcgcagtattgttgaaccagttcgtaacattgtt
aggaagaaaaatgttgacatttgtttctgggaagctgaatgtttcaagattgatgcagaa
aataagaaagtatattgtcgatctagtcaaaataccaatctgaatggcaaagaagaattt
tgtatggactatgactaccttgtaatagccatgggtgctcgtgctaacacattcaataca
cctggagtagaggagaattgtaacttcttgaaggaagttgaagatgcccagagaatacgt
aggaatgtcattgaatcctttgagaaggctagcctccctaacctaagtgacgaagagaga
aagaggattcttcattttgtgattgttggtggtggcccaacaggtgtggagtttgctgcg
gagcttcatgattttgtagatgaggatttatttaagctctatcctaaggtcaaggattca
gtgaaaataacacttctggaggcagcagaccatatcctcaacatgtttgacaaaagaatc
acagcttttgctgaagagaagttctccagagatggaattgacgtaaaactgggatcaatg
gtcgtgaaagtgactgacaaagaaattttcaccaaagtacgaggaaatggagaaacttct
tctatgccatatggaatggttgtctggtcaaccggcattgcacctcatgctattataaag
gattttatgaagcaagttggtcagactaataggcgtgctttggcaactgatgaatggctg
cgggttgagggatctgatagcatttatgcacttggtgattgcgcaacagttaaccagcgc
agagtcatggaagatattgcagctatatttagcaaggcagataaggacaattctggaacg
cttactgtcaaagaatttcaagaagtcattaaggacatttgtgagcggtaccctcaagtg
gagctgtatttgaagaataagaagatgggtgattttggtgatttattgaaagaggccaaa
ggggatgttgcccaagatgctgtcgagttgaacattgaagaatttaagaaagctctttcc
gaagtggattctcagatgaaaaatctcccggcaacagcacaggttgcagctcagcaaggc
aaatatcttgccaagtgtttcaaccgcatggaagaagctgaaaagaatccagaaggtcct
ctcaggttcaggggaacaggtcgccatcggtttcagccatttaggtatcagcacttggga
caatttgctccacttggaggagagcaaactgcggcacaacttccttgggattgggtttca
attggcaggagctcacaatggctttggtattctgtctacacaagcaagctagtgagctgg
cgtacaagggctttggttgtatcggattggacgaggcgtttcatcttcgggagagattca
agtggaatttga

DBGET integrated database retrieval system