KEGG   Citrus sinensis (Valencia orange): 102630080Help
Entry
102630080         CDS       T02983                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1 isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00052  Galactose metabolism
cit00500  Starch and sucrose metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102630080
   00500 Starch and sucrose metabolism
    102630080
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102630080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 102630080
NCBI-ProteinID: XP_006466029
UniProt: A0A067FQ11
Position
1
AA seq 573 aa AA seqDB search
MANFYLSLFLFFALFLGHGVVELQASHHVYRNLQTSQSTSPNQPYRTGYHFQPPKNWIND
PNGVMIYKGIYHLFYQYNPKGAVWGNIVWAHSTSKDLINWIPHDPAIYPSQQSDINGCWS
GSATILPGEKPAIFYTGIDPHNRQVQNLAVPKNLSDPYLREWVKSPKNPLMAPDAMNQIN
TSSFRDPTTAWLGPDKRWRVIIGSKINRKGLAILYRSKDFVHWIKAKHPLHSVKGTGMWE
CPDFFPVSTYGLNGLDTSDMGPNTKHVLKVSLDDTKHEYYTVGTYSTAKDRYVPDEGSVE
SDSGLRFDYGKYYASKTFFDGAKNRRVLWGWVNESSSVNDDVKKGWAGIQAIPRKLWLDK
SGKHLVQWPVVEIEKLRVNQVQVPSKLLKGGSVIEVTGVTAAQADVEISFDVSDFKKAEK
LDPGWTNPQLLCSQKGASVKGALGPFGLLALASKDLKEYTAVFFRIFKGEDNKFVVLMCS
DQSRSSLNSDNDKTTYGAFLNVDPVYEKLSLRSLIDHSIVESFGVGGKACITARVYPTLA
IDDYAHLYAFNNGTENVKINGLSAWSMKKAQLY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaatttttatctcagtttattccttttctttgctctctttcttggccatggtgtt
gttgagctccaagcttctcaccatgtttacagaaaccttcaaacttctcaatctacttca
cctaatcaaccttacaggactggctaccatttccagcctcccaagaattggatcaatgat
cccaatggtgttatgatttacaaaggaatttatcacctgttctaccaatacaacccaaaa
ggagcagtatggggcaacattgtatgggctcactctacatcaaaggacctgattaactgg
atcccacatgatccagccatctacccatcacagcagtccgatatcaacggttgctggtcg
ggttcagccacaatcctgcctggagaaaaaccagccattttttacactggaattgaccca
cataaccgacaggtccaaaacctggccgtgccaaaaaacttatctgatccttaccttagg
gaatgggttaagtcaccaaaaaatccattgatggcacctgatgccatgaatcaaatcaat
acaagctcattcagagacccaaccacagcatggcttggccctgataagagatggagagtg
atcatcggcagcaaaattaacagaaaagggttagcaattttgtacagaagcaaagatttt
gtgcattggattaaggctaaacaccctttacattctgttaaaggcacaggaatgtgggag
tgtcctgattttttccctgtttctacttatggcctaaatggtcttgatacatcggatatg
ggacccaacactaagcatgtgcttaaggttagcttggatgatactaagcatgaatattac
acagttggaacatatagcactgctaaagatagatatgttccggatgagggttccgtggag
agtgattcaggattgagatttgattacggaaaatattatgcttccaagactttctttgat
ggtgccaagaacaggagggttttgtggggttgggttaatgagtcatcaagtgttaatgat
gatgtcaagaagggctgggctggaatacaggcaattcccaggaaactttggttagataaa
tctggcaaacatttggtccaatggcctgttgttgaaatcgaaaagttacgtgtaaaccaa
gtgcaagtacctagcaaattgctgaagggaggatctgtgattgaagttactggtgttact
gctgctcaggcagatgttgagatttcatttgatgtgagtgattttaagaaggcagaaaag
ctggacccagggtggaccaatccacagttgctttgtagccaaaagggcgcatcagttaaa
ggcgctcttggtccatttgggctgctcgctttggcttcaaaagatttgaaagaatacaca
gcagtgtttttcagaatattcaaaggcgaagacaacaagtttgtggtgcttatgtgcagt
gaccaaagcaggtcttccttgaatagtgataatgataagaccacttatggcgcatttctg
aatgtggacccagtttatgaaaagctgtcgttaaggagtctgattgatcattcaatagtg
gagagctttggtgttggaggcaaagcctgcatcacagctagagtgtatccaactttggca
attgatgattatgcccacttgtatgcattcaataatggcactgagaatgtcaaaatcaac
ggcctgagtgcctggagtatgaagaaagctcaactttattaa

DBGET integrated database retrieval system