KEGG   Citrus sinensis (Valencia orange): 102631410Help
Entry
102631410         CDS       T02983                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102631410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cit03041]
    102631410
Enzymes [BR:cit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102631410
Spliceosome [BR:cit03041]
 Complex C
  Other components
   Step II factors
    102631410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA ABC_tran Sigma54_activ_2 Flavi_DEAD PhoH AAA_16 AAA_14
Motif
Other DBs
NCBI-GeneID: 102631410
NCBI-ProteinID: XP_006466902
Position
1
AA seq 1176 aa AA seqDB search
MDPPASDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKE
NGAEMPDYFVRTLLTIIHAILPPKSKSADKESKKEGGGDGKKTKFKALAIEDSRDKVKDL
ERELEAEARERRRGNEDREREDHYRNRDRDRDRQDRDRDRGRRDRDNQRGRHYVDDDDGG
DRSRGRYRDRHETARRYDNKYGDRENDDSGDRSGRYRGNEPELYQVYKGRVSRVVDTGCF
VQLNDFRGKEGLVHVSQIATRRIGNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQNTG
KDLLPLKKISEDDALGNNPSGTRDGPTTRMGLSGIRIVEEDGVVPSRRPLKRMSSPEKWE
AKQLIASGVLSVEDYPMYDEEGDGLAYQEEGAEEELEIELNEDEPAFLQGQTRYSVDMSP
VKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHL
AQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQ
VLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEV
GYAIRFEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVIMLDEAHERTIHTDVLFGLLK
QLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLI
TVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQS
RIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQA
SAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGFTTLTMKAMGINDLLS
FDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCS
DEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWC
FENFVQSRSLRRAQDVRKQLLSIMDKYKLDVMSAGKNFTKIRKAITAGFFFHAARKDPQE
GYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVDLAPRFFK
VADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggatcctccagcctcagacgatggtctaaagaaattagagtacttttctcttgtctct
aaagtctgttccgagttagaaactcatctagggttcggggacaaagttttagcggagttc
ataaccgagttgggtcgtaactgcgaaactgttgatgaatttgattctaaactgaaagaa
aacggcgccgagatgcctgattattttgtccgtacattattgactatcatccacgccatt
cttccaccgaagtcgaaatcagcagataaagaatcaaaaaaagagggtggtggtgatggt
aaaaaaacaaagttcaaggctcttgctatagaagatagtagggataaagtcaaagacctt
gagagagaacttgaagctgaggcacgtgagcggcggagaggaaatgaggatagagaaaga
gaagatcactataggaacagggatagggatagagaccgccaagatagagatcgtgataga
ggtagaagagacagagataatcaaagagggaggcattatgttgacgatgatgatggtgga
gataggagtagaggaagatatagggatcggcatgagacggctaggagatatgataataaa
tacggtgatagagagaatgatgattccggagataggagtgggcggtacagaggtaatgag
cctgagttgtaccaggtgtacaagggaagagtatcgagagttgtggacactggctgtttc
gttcagttgaatgattttaggggtaaggagggtctggttcatgtttcccagattgcaact
agaaggattggtaacgctaaagatgttgtgaagcgggatcaggaggtgtatgtcaaggtg
atttcagtttcaggtcagaagttgagtctttccatgagggatgttgatcagaatactggt
aaggatttgcttccactgaagaagatctcagaggatgatgcacttgggaataatccttct
ggaacaagagatgggccaacaactaggatgggtttgtcagggatcaggattgtggaggag
gatggtgtcgttccctcccgcaggccgttgaagagaatgagctcaccggagaaatgggaa
gcaaaacaactgattgcttcaggggttttgtctgtggaggattatcctatgtatgacgag
gaaggggatgggttggcttatcaagaagagggtgctgaggaagagcttgagattgaactt
aatgaggatgagcctgcgtttttgcaagggcagaccaggtattctgtagatatgtcacct
gtaaaaatttttaagaatccagaaggctcattgagtcgtgcagctgctcttcaatctgct
ctcataaaggagcggagagaagtacgggaacaacagcagaggacaatgcttgattcaata
ccaaaggatctgaatcggccatgggaggatccaatgcctgagacaggtgaaaggcatcta
gcacaggagcttaggggtgttggtttatcagcatatgacatgcctgaatggaagaaggat
gcatttgggaaagcattgacttttgggcagaggtcaaagctctctatccaggaacagagg
cagagcttgccaatttataaattgaagaaggaactaatccaggctgtgcatgataatcag
gtattggtagtcattggtgaaacgggttctggcaagacaacccaagtaacacagtatctt
gcagaggctggttacactacaagaggtaaaattgggtgtactcagccccgtagggtggct
gcaatgtctgtggccaagagggttgctgaagagtttggttgccgtttgggggaggaagtt
gggtatgctatacgatttgaggattgtactggaccagatactgtgatcaaatacatgact
gatggtatgcttcttagggagattttgatagatgataatctttctcagtattcagtgatt
atgcttgatgaagctcatgagaggacaatccacactgatgttctttttgggttgctcaag
cagcttgttaagcggagaccggatcttcgactgattgtcacatctgccacgttagatgct
gagaagttttcagggtatttcttcaactgcaacatctttacaattcccgggagaactttc
cctgttgagatactctacaccaagcagccagaaagcgattatttggatgcatcactgatc
actgtcttacaaatccatttgacagagcctgaaggtgatattcttctcttcttgactgga
caggaggagattgattttgcatgccagtctctttatgagaggatgaaaggtctaggtaaa
aatgttcctgagctaatcatattaccagtttacagtgccctccctagtgaaatgcaatct
agaatatttgaccctgccccgccaggaaagagaaaagtggttgtggccactaatattgct
gaagcttctttgacaattgatggaatattctatgttatcgatcctgggtttgcgaaacag
aatgtttataatccaaagcaagggcttgattcactggtcataactcccatttcacaagca
tcagccaagcagcgagctgggcgtgcagggcgtacggggcctggaaaatgttaccggtta
tacacagagagcgcttaccgcaatgagatgtcccctacatcaattccagaaatccaaagg
atcaatcttggatttactactcttacaatgaaggccatgggaataaatgatctactgtca
tttgattttatggatccaccttcaccccaagctctcatttctgccatggagcagctgtac
agtctaggtgctttggatgaggaagggcttttgactaaattgggtaggaaaatggcagaa
tttcctttggatcctccattatccaagatgttgctggccagtgtggaccttgggtgcagc
gacgagattttgacaataattgccatgattcagaccggcaacattttctataggcctagg
gaaaagcaagctcaggcagatcagaagagggctaagtttttccagcctgagggagatcat
ttgaccttgcttgctgtgtatgaggcatggaaagcaaaaaacttttcagggccttggtgt
tttgagaactttgttcagtctcgatccttgaggagggcacaggatgtcagaaaacaactt
ctcagcattatggataaatataagttggatgttatgagtgctggaaagaatttcacgaag
ataaggaaggcaattacagcaggattcttttttcatgctgctagaaaggacccacaggag
ggctatcggaccttagttgagaatcagccggtttatatccacccaagcagtgcactattt
cagagacaacctgattgggtcatctaccatgagctcgtcatgactactaaggagtacatg
cgtgaggtaacggttatagatccaaagtggctcgtggatttggcaccaagattcttcaag
gtggcggatcctacaaaaatgagcaagcgtaagcgtcaagaacgtattgaaccactatat
gatagatatcatgaacctaactcctggaggttgagtaaacggcgtgcatga

DBGET integrated database retrieval system