KEGG   Citrus sinensis (Valencia orange): 107176426Help
Entry
107176426         CDS       T02983                                 

Definition
(RefSeq) putative cysteine-rich receptor-like protein kinase 16
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cit01001]
    107176426
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107176426
Protein kinases [BR:cit01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107176426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase Pkinase_fungal APH RIO1
Motif
Other DBs
NCBI-GeneID: 107176426
NCBI-ProteinID: XP_024953037
Position
4
AA seq 154 aa AA seqDB search
MSFLQGILAKGQEIAVKRLSKTSQQGLQEFENEVKLTARLQHVHLVPVLGICIQREEKML
IYEYMPNKSLDYYIFDPRRRHLLDWRQRVHIIEGVTQALLYLQEYSNFTIVHRDLKASNI
LLDKEMKPKISDFGIARAFTKDACEANTGRIVGT
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttttacaggggatattagccaagggacaggaaatagctgtgaaaagactttcc
aaaacttcacaacaagggcttcaggagtttgaaaatgaagttaagcttactgcgagactt
caacatgtacatctagttccggttttgggaatttgtatacagagggaagaaaagatgctg
atttacgagtatatgccaaacaagagcctggattactacatttttgatcctcgcaggcgg
catctcttagattggaggcaacgcgtgcatatcattgaaggggttactcaagcacttcta
tatctacaagaatactcaaatttcacaattgttcatagagatttaaaggctagtaacatt
ctgctggacaaagagatgaagcccaagatatctgatttcggaatagctagagcttttaca
aaggatgcatgtgaagcaaacacaggccggatagtcggaacatag

DBGET integrated database retrieval system