KEGG   Citrus sinensis (Valencia orange): 112495491Help
Entry
112495491         CDS       T02983                                 

Definition
(RefSeq) heat shock 70 kDa protein 6, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03040  Spliceosome
cit04141  Protein processing in endoplasmic reticulum
cit04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112495491
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112495491
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112495491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cit01009]
    112495491
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cit03041]
    112495491
   03009 Ribosome biogenesis [BR:cit03009]
    112495491
   03110 Chaperones and folding catalysts [BR:cit03110]
    112495491
   04131 Membrane trafficking [BR:cit04131]
    112495491
   03051 Proteasome [BR:cit03051]
    112495491
   03029 Mitochondrial biogenesis [BR:cit03029]
    112495491
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cit04147]
    112495491
Protein phosphatases and associated proteins [BR:cit01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112495491
Spliceosome [BR:cit03041]
 Complex B
  Other components
   Prp19 complex
    112495491
 Complex C
   Prp19-CDC5 complex
    112495491
Ribosome biogenesis [BR:cit03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112495491
Chaperones and folding catalysts [BR:cit03110]
 Heat shock proteins
  HSP70 / DNAK
   112495491
Membrane trafficking [BR:cit04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112495491
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112495491
Proteasome [BR:cit03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112495491
Mitochondrial biogenesis [BR:cit03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112495491
Exosome [BR:cit04147]
 Exosomal proteins
  Proteins found in most exosomes
   112495491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA BcrAD_BadFG FGGY_C StbA PilM_2 DUF5398 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 112495491
NCBI-ProteinID: XP_024948924
Position
Unknown
AA seq 714 aa AA seqDB search
MACSSAAQIHFLGNISLSSRKNSKNGRQNTAGSRNLFFGKRVGGNRFGSVPSAAFLRLKS
ENRGGRYVGPVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNG
DRLVGQIAKRQAVVNPENTFFSVKRFIGRKMVEVDEESKQVSYRVVRDENGNVKLECPAI
GKQFAAEEISAQVLRKLVDDASKFLNDSVTKAVVTVPAYFNDSQRTATKDAGRIAGLDVL
RIINEPTAASLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDD
FDKRIVDWLASNFKRDEGIDLLKDKQALQRLTETAEKAKMELSSLTQTNISLPFITATAD
GPKHIDTTLTRVKFEELCSDLLDRLKTPVETSLRDAKLSFKDLDEVILVGGSTRIPAVQE
LVKKMTGREPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSLGLETLGGVMTKI
IPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQ
IEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRD
AIDTKNQADSVVYQTEKQLKELGDKVPAEVKGKVEGKLKELKDAIAEGSTQAMKDTMAAL
NQEVMQLGQSLYNQPGAGAAPGAGPTPGAEAGASDSSNKGQDGDVIDADFTDSK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttcatcggcagctcaaattcatttcctcggtaatatttcattgtcgtcgaga
aaaaacagtaaaaacggtcgtcagaacacggcggggtcgagaaatttgttttttgggaaa
agggttggcgggaaccgattcgggtcggttccaagcgctgcgtttttgaggttgaagagt
gagaacagagggggaaggtatgtggggccggtgagggtggtgaatgagaaggtggtgggg
attgatttggggacgacgaattcggctgtcgcggctatggaaggagggaagccgactata
gtgacgaatgctgaggggcaaagaacgacgccgtctgtggtggcgtacacgaagaatggg
gataggttggtgggtcagattgcgaagaggcaggcggtcgtgaacccggagaacaccttc
ttttcggtgaagaggtttattgggaggaagatggtggaggttgatgaggaatcgaagcag
gtttcgtatagagttgtgagagatgagaatgggaatgtgaagttggagtgtcctgctatc
ggcaagcagtttgctgctgaagagatttcggcccaggtcttgagaaagcttgtcgatgat
gcgtccaagttcttaaatgatagtgtgactaaagcagtggtcacagtgcctgcttacttc
aatgattcccagagaacagcaacaaaggatgctggtcgaattgctggcttagatgttctg
cgtataattaatgagcctactgctgcttcgttggcatatggatttgaaaagaaaaacaac
gagaccatcctagtgtttgaccttggtggtggtacttttgatgtttcagtccttgaggtc
ggtgatggagtgtttgaagtgctctccacctcaggcgatacgcatttgggtggtgatgat
tttgataagaggattgttgattggcttgcttcaaacttcaagagagatgaaggcatagat
cttttgaaggacaaacaagctcttcagcgtctaactgagacggctgagaaggctaagatg
gagctgtcatctttgactcaaacaaacatcagcttgcctttcattactgctactgcagat
gggccgaagcatattgacaccacccttacgagggttaagtttgaggaattgtgttcagac
ctactggacaggctcaagacgcctgttgaaacttctttgcgggatgcaaaactttccttc
aaggatcttgatgaggttattcttgttggtggatcaacacgtattccagctgttcaggag
ctggtgaagaagatgactggaagggaaccaaatgttacagtcaatcctgatgaagttgtt
gccctaggagctgccgttcaggctggtgttcttgctggtgatgtcagtgacattgttctg
ttggatgtgaccccattatctcttggtttggaaaccttgggtggtgtgatgaccaaaatt
attcctagaaatacaactttgcccacttccaagtcagaggtgttctcaacagctgctgat
ggtcagaccagtgtcgagatcaatgttctccaaggtgaaagagaattcgtgagggacaac
aaatctcttggcagcttccgtcttgatggcatccctccagcaccgcgtggggttcctcaa
attgaggttaaatttgacatcgatgccaatggtattctttctgtctctgctgttgacaaa
ggcaccggaaagaaacaagacatcaccattactggtgctagcactttacccaatgatgag
gtgcaaagaatggtgcaagaagctgagagatttgccaaggaggataaagagaaaagagat
gctattgacaccaagaaccaggcggattctgtcgtataccaaacggagaaacagctgaag
gagctgggagacaaggttccagccgaagtgaaggggaaggtcgaaggaaaactcaaggag
ctcaaggatgcaattgcagagggttcaacccaagcaatgaaggacactatggccgccctt
aaccaagaagttatgcagcttggccagtccctttacaaccaaccaggagctggggctgca
cctggcgctggacctactcctggtgctgaggctggagcttcagactcatccaacaaagga
caggatggtgatgtcatcgatgcagatttcactgacagcaagtga

DBGET integrated database retrieval system