KEGG   Citrus sinensis (Valencia orange): 112498156Help
Entry
112498156         CDS       T02983                                 

Definition
(RefSeq) probable inactive receptor kinase At2g26730
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cit01001]
    112498156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_4 LRR_8 LRRNT_2 FAM176 LRR_5 Orf78 DUF5383
Motif
Other DBs
NCBI-GeneID: 112498156
NCBI-ProteinID: XP_024953889
Position
5
AA seq 604 aa AA seqDB search
MNALFTLKAMFNDPFLIQNWTGIHCFKDFPSQWYGIQCDINSAHVTGIVLEDMRLNGEIK
SDAFADIPELIVINFKNNIISGNFMNFSSNHKLKDIDLSGNKFYGEISRSLLSLKFLESL
QLQNNNLTGPVPEFNQSSLKVFNVSNNNLSGSIPKTQTLQLFSSYSYSNNPYLCGPQSFN
NCSSTGNYVTNSDDKGSNDLKIFYFLLAALCIVTVLMLFIFYLTKRTRKRNIMIKKQEEY
MDQEKESGDDEEEEEEKIGKGKRKLVVAGEDRNLVFIDDEQPAGFKLNDLLKAPAEGLGK
GIFGNSYKALLEGRAPVVVKRLRDLKPLSTEELRKQLLVIADQKHPNLLPLLAYYFSNDE
KLLVYKFAGNGNLFNRIHGGKSSKNRIPFRCWPRLLVARGVARALEYLHHKDKSRTQSAV
IHGNLKSTNILLDDNEMVIVSDYGFSSLVAQPIAAQRMISYKSPEYQSSKKISRKSDVWS
FGCLLLELLTGRISTHSAPQGINGADLCSWVLRAVREEWTAEIFDSEISVQRSAAHGMLK
LLQVAIQCCNKSPEKRPEMAEVVSELEIIKVTESTEEEEDFSLDQSLTDESLSISTVASA
SERP
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctctatttactctcaaggctatgtttaatgatccatttttaattcaaaactgg
acaggcattcattgcttcaaggattttccttcacagtggtatggcattcaatgtgacatc
aacagcgctcatgttactggaatagtgttagaagatatgcgcctgaatggtgaaataaag
tcggatgcgttcgcagacattcccgaactgatagtcattaacttcaagaacaacataata
tcaggaaattttatgaatttctcgtcaaatcacaagttgaaggatattgatctttcgggc
aataagttctatggggagatttcaagatcactattgagtcttaaatttttagagtcatta
cagcttcaaaataacaatttgacaggtccagtcccggagtttaatcagtctagcttgaaa
gttttcaatgtctcaaacaacaatctcagtggctccatcccgaaaactcaaactctccag
ttatttagtagctattcctattctaataatccttacttatgcggtccacaatcttttaat
aattgtagttccaccggaaattatgtaacaaattctgatgacaaaggatctaatgacttg
aaaatcttttattttcttctcgctgccctttgtattgttactgtattaatgctcttcatt
ttttaccttacgaaaagaacaagaaagcggaacataatgatcaagaagcaggaagaatac
atggaccaagaaaaggagagtggagatgatgaagaagaagaagaagagaaaattggaaag
ggcaaaagaaagttagttgttgcaggagaagacaggaatctcgtattcattgacgatgaa
cagcctgcggggttcaaattgaatgatcttttgaaagctccagctgaaggattaggaaag
gggattttcggaaatagttacaaagctttgcttgaaggcagagcacctgttgttgttaag
cgcctacgagacttgaaaccactaagcactgaagaattgagaaagcaactgcttgttatt
gctgatcaaaagcatcccaatttgctaccacttctagcttactacttttccaacgatgag
aaattgcttgtctacaaattcgctggaaatggaaacctctttaaccgcattcacggtggg
aaatcaagtaagaatcggattccatttcgatgttggccaagattattggtggctagaggt
gtagcacgagccttggaatatcttcaccacaaagataagagcaggacacaaagtgcagtc
attcacggcaatctaaaatcaaccaacattcttctcgatgataatgaaatggttattgtt
tcagattatggcttttcttcattagtggcacaacccattgcagctcaacgaatgatctca
tacaaatctcccgaataccaatcttcgaaaaagatttcgagaaaatctgatgtctggagt
ttcggatgccttcttttagaactattgacgggaagaatctcgacacactcagctccgcag
ggaatcaacggtgcagatctttgtagttgggttcttcgagcggtaagagaagagtggacg
gctgagatatttgactccgagatatctgtgcagagaagtgctgctcatgggatgcttaaa
ctactacaagttgcaatacaatgctgcaataagtcaccggagaagagacctgagatggcg
gaggttgtgagtgagctggagattataaaggtgactgaatcaacagaagaggaagaagat
ttttcattggatcagtctttaacagatgaatctctgtctatcagtacggtcgcgtctgcc
tcggaaaggccttga

DBGET integrated database retrieval system