KEGG   Citrus sinensis (Valencia orange): 112498323Help
Entry
112498323         CDS       T02983                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5
Organism
cit  Citrus sinensis (Valencia orange)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin PAN_2 S_locus_glycop Kinase-like Pkinase_fungal Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 112498323
NCBI-ProteinID: XP_024954922
Position
5
AA seq 818 aa AA seqDB search
MAVALELMIMIFIMNLCATNATQSTAHNNTSWQNNQGSAQESYNFVDGSHVRTLLVRKGT
SKSYPKFGFGFLRNGTTDEIFYLVTVRFMGTITSSSNHQNHPPVILWFANGQSPVKENAT
LEFTADGDLILKDVDGTRVWSTETSGSNVTRITLDGNGNLRLYDAENRPHWISFLHPTNT
WLPGQRLHVHKMMASTNSTTSLSQGKFILSLSPKGIEVFLNMSTVKRFQTIPYRNYFLNM
SSAVLNKSAILVFNKSGSHITYDVAPRSKFHYMRLEPNGHLNIYQLDNGYSDNADLSRDE
HYGDCIYPTKCGNYGVCSNGECTCPGSSSYFKQSNDSGNGFSCAEVNHLSCQLKHLQRFL
KLENVTYFDFVPHLINIDAEGCQRACLGNCSCKAALFRYQGSLSTGNCSLPTEIYTLRNS
TKVISGYNDITFIKVQLPSDQNKLSVLFMLLLSVSAFLLLVIGASIYLYKRWREGKRRDK
STDESSVHVANHLVKFSSKAMKSATRDFQIRLGRGGSGSVFEGLLNDGTKVAVKRLYPGE
NRGKKEFLSEVETIGNIHHFNLVRLVGYCAERSNRFLVYEYMCNGSLDKWIFHKDRIQTL
SWDIRKKIIFQISRGLEYLHDYCNPKIIHFDIKPQNILLDRDLNVKIADFGLARLIAQDQ
SHVSTMPKGTPGYMAPELTRGNNITAKIDIYSFGVVMLEIICGRRSSNPKGGDYLVDTLK
VKAEADRLCDLVDKKSEDMQSHRDDAVKMIQIAISCLQKNLHRRPSASMLVKVLQGLTKL
EPVTDYGFLSFAVVEATTQEVVPIRSSPITAATLSGPR
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagcactagaactcatgatcatgatcttcatcatgaacctttgtgctacaaat
gccacccaatcaacagcacacaacaacacttcttggcaaaacaaccaaggttctgcacaa
gagagctacaattttgtcgacggatcccatgtcagaaccttacttgtacgtaaaggtacc
tcaaagagctacccaaagtttggtttcgggtttttgagaaatggtacaactgatgagatc
ttctatctcgtgacggtcagattcatgggaacgatcacatcctcctctaatcatcagaac
cacccgccggttattctctggttcgccaatggacaatcccccgtcaaagagaatgccaca
cttgagtttactgcagatggtgatttgatcttgaaagatgtagatggtacccgcgtttgg
tctacagaaacctcaggcagcaatgttacacgcattactttagatggaaatggaaacttg
agactttatgatgctgaaaatcgaccgcattggatctcatttcttcatccaactaacaca
tggctgccaggacagcgcttgcatgttcacaaaatgatggcttctacaaattcgactacc
agtctttcccaaggcaagttcatcctaagtctatctcccaaaggcattgaagtttttctg
aatatgagtactgtaaaaagatttcaaaccattccataccgaaattattttctgaatatg
agttccgctgtactcaataaatctgccattcttgtattcaataaatccggcagtcatatc
acctatgatgtcgcaccaaggtcaaaatttcactacatgaggctggaaccaaatgggcac
cttaatatttatcagcttgataatgggtactcagacaatgctgatctctcaagagatgaa
cattatggggactgtatttaccccactaaatgtggcaattatggggtctgctctaatggt
gaatgcacttgtcctggaagttcaagttatttcaagcagtcaaatgatagtgggaacggc
ttttcctgtgccgaagttaatcatttgtcttgccaactcaagcatcttcaaagattttta
aagcttgaaaatgttacttacttcgactttgtccctcatctcatcaatatagacgcagag
ggctgccaaagggcctgcctgggcaattgttcttgcaaagctgccttgtttcggtaccaa
ggaagtctctcaactggtaattgttctttaccaactgaaatttatactctgaggaatagt
accaaagtgatttctggttataatgacataacattcatcaaggtacaattgccatcggat
caaaataaactttctgtgcttttcatgttgctattgtctgtttctgcctttttactcttg
gttattggagcaagtatttatttgtacaagagatggcgggaaggcaaaaggagagacaag
tccactgatgaatcttcagttcatgtagccaaccatttggtgaaattttcatccaaagct
atgaaatctgccacaagggactttcagattaggcttggtcgaggaggatccggatctgtt
tttgaagggttgcttaatgatggcactaaagttgcagtgaaacgcttatatcctggtgag
aaccgaggcaagaaagaatttttgtctgaggttgagacaataggcaatattcaccatttc
aatctggtaagactagttggctattgtgctgaaagatcaaacagattcctagtttatgag
tacatgtgcaatgggtcacttgataaatggatttttcacaaagaccgaattcaaactctt
tcttgggacataagaaagaaaattatttttcagatatcccggggactagagtatttgcat
gactactgtaatccaaaaatcattcactttgacatcaaacctcaaaatatcctcctggat
agagatttgaatgtcaagattgctgatttcggattagccagattgattgctcaggatcaa
tctcatgtgtcaacaatgccaaagggcactccagggtacatggctccggagttaaccaga
ggaaacaatatcactgcaaagattgatatttacagctttggagttgtgatgttagagatc
atttgtgggaggagaagttcaaatcctaagggtggtgattatttagtggatacactgaag
gtcaaggcagaagcggaccgactttgtgatctagttgataaaaaaagcgaggatatgcaa
agtcacagagatgatgctgtgaagatgatccagattgccatttcttgcttacaaaagaat
ttgcatagaaggccttctgcatcaatgttggtcaaggtcttacagggcttaacaaaattg
gaacctgttactgactatggtttcttaagctttgcagttgtagaggcgacaacccaagaa
gtcgttccaattcgttcatctcctatcacagcagcaacactatcaggaccaagatga

DBGET integrated database retrieval system