KEGG   Citrus sinensis (Valencia orange): 36487056Help
Entry
36487056          CDS       T02983                                 

Gene name
nad9, DDH47_mgp08
Definition
(RefSeq) NADH dehydrogenase subunit 9
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00190  Oxidative phosphorylation
cit01100  Metabolic pathways
Module
cit_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    36487056 (nad9)
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     36487056 (nad9)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     36487056 (nad9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 36487056
NCBI-ProteinID: YP_009477476
Position
MT
AA seq 190 aa AA seqDB search
MDNQSIFKYSWETLPKKWVKKMERSEHGNRSDTNTDYLFQLLCFLKLHTYTRVQVSIDIC
GVDHPSRKRRFEVVYNLLSTRYNSRIRVQTSADEVTRISPVVSLFPSAGRWEREVWDMFG
VSFINHPDLRRISTDYGFEGHPLRKDLPLSGYVEVRYDDPEKRVVSEPIEMTQEFRYFDF
ASPWEQRSDG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggataaccaatccattttcaaatatagttgggagactttacccaagaaatgggtcaaa
aaaatggaaagatcggaacatgggaatagatctgataccaatacggactacctatttcaa
ttgttgtgctttcttaaattgcatacctatacaagggttcaagtttcgatcgatatttgc
ggagttgatcatccttctcgaaaacgaagatttgaagtggtctataatttactgagtact
cggtataactcacgcattcgtgtacaaaccagtgcagacgaagtaacacgaatatctccg
gtagtaagtctatttccatcagccggccggtgggagcgagaagtttgggatatgtttggt
gtttctttcatcaatcatccggatctacgccgtatatcaacagattatggtttcgagggt
catccattacgaaaagaccttcctctgagtggatatgtggaagtacgctatgatgatcca
gagaaacgtgtggtttctgaacccattgagatgacccaagaatttcgctatttcgatttt
gctagtccttgggaacagcgtagcgacggataa

DBGET integrated database retrieval system