KEGG   Cellvibrio japonicus: CJA_0481Help
Entry
CJA_0481          CDS       T00721                                 

Definition
(GenBank) pho4 family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cja  Cellvibrio japonicus
Brite
KEGG Orthology (KO) [BR:cja00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CJA_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ycf66_N
Motif
Other DBs
NCBI-ProteinID: ACE84111
UniProt: B3PIX0
Position
complement(586912..588186)
Genome map
AA seq 424 aa AA seqDB search
MTLFAEYGQVLFVLACVFGLFMAWGIGANDVSNAMGTSVGSRALTMKQAIIIAMVFEFAG
AYLAGGEVTETIRSGIVELDIMSSHPDLFVYGMLSSLLAAGSWLLIASILGWPVSTTHSI
VGAIIGFAAVGISVDAVQWGQVWGIVGSWIITPVIAGFISFWIFRSVQHLILDTEDPFGN
AKRYIPFYMFAVGFFLSMVTLLKGLKYVLKEHHIEFGFIQAVVIAALIGIAVAGIGIYLL
SRINQDTHADKSNRFSSVERVFGVLMIFTACSMAFAHGSNDVANAVGPVAAVIAVVQAGA
VETKALVPSWVLLLGATGIVIGLATYGYKVMVTIGKKITELTPSRGFAAEMAAAATVVIA
SGIGLPISTTHTLVGAVLGVGLARGIGALNLGVIGGIFASWVITLPAGAGLSILFFYFFK
GLFS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactttatttgctgaatacggccaggtgctgtttgttctggcgtgcgtttttggcttg
tttatggcctggggcattggcgccaacgatgtgtccaatgcaatgggaacctcggtgggc
tcgcgtgcgctcaccatgaagcaggcgattattatcgccatggtgttcgagtttgccggt
gcttatctcgccggtggtgaagtaacagaaactatccgcagcggtattgttgagctggat
atcatgtccagccaccccgacctgtttgtctacgggatgctctcctcactgctggcggcg
ggcagttggctgctaatcgccagtatcctcggctggccggtatccactacccactcgatt
gtcggggccattattggcttcgccgccgtgggtatttcagtagatgcggtacagtggggc
caggtatggggcattgtgggcagctggataattaccccggtgattgccggctttatctcc
ttctggattttccgctcggtgcagcaccttatcctggacaccgaagatcctttcggcaac
gccaagcgctacattcccttttacatgtttgcagtgggctttttcctgtccatggttacc
ctgctcaaagggctcaagtatgtgctcaaggagcatcatattgagttcggtttcatccag
gcagtggtgattgccgcactcattggcattgcggttgccggtataggtatctacctgctc
agccgtatcaaccaggatacgcatgcggacaaaagcaatcggttttccagcgtggagcgt
gtatttggcgtcctcatgatttttaccgcctgctccatggcatttgcccacggctccaac
gatgtggccaatgccgtaggcccggtagcagcggtaatcgccgtggttcaggccggagca
gttgagaccaaagccctggtgccgtcctgggtattgctgctgggtgccaccggcattgtt
attggcctggccacctacggctacaaagtcatggtgaccatcggcaagaaaattaccgaa
ctgacccccagccgcggttttgccgcagaaatggccgccgccgccacggtggttatcgcc
tcgggtattggcctgcccatttctaccacccataccttggtaggcgcggtattgggcgtc
ggcctggcgcgcggtattggcgccctgaacctgggggttatcggcggcattttcgcctcc
tgggtaatcaccctacccgccggtgccggcctatccattctcttcttttacttctttaaa
gggctattcagctaa

DBGET integrated database retrieval system