KEGG   Cellvibrio japonicus: CJA_1506Help
Entry
CJA_1506          CDS       T00721                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cja  Cellvibrio japonicus
Pathway
cja00020  Citrate cycle (TCA cycle)
cja00310  Lysine degradation
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01120  Microbial metabolism in diverse environments
cja01130  Biosynthesis of antibiotics
cja01200  Carbon metabolism
Module
cja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJA_1506 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CJA_1506 (sucB)
Enzymes [BR:cja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CJA_1506 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACE83765
UniProt: B3PDP6
Position
1743769..1744965
Genome map
AA seq 398 aa AA seqDB search
MSIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVVAPADGSIAEIV
KGEGETVLSNEVIARFAEGAVAAAPAAAATPAAEAKPAAAPAEKLVNPAARKLAEENNVN
TAAVSGTGKDGRVLKEDVANHLKSAPAATPAVAAPAPAPIEAAGERVEKRVPMTRLRKRI
AERLLEASSTTAMLTTFNEVNMKPVMDLRAKYKDQFEKVHNGTRLGFMSFFVKAAAEALR
RFPVVNASIDNNDIVYHGYQDIGVAVSTDKGLVVPVLRNTENMSLAGIENAIRDFGLRAR
DGKLGIEEMSGGTFTITNGGVFGSLLSTPILNLPQSAILGMHKIQERPMAVNGKVEILPM
MYLALSYDHRLLDGKDAVQFLVTIKDLLEDPARLLLEI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaagcccctacgttccctgaatccgttgctgacggcacagttgca
acctggcacaaaaaaccgggtgaagctgtcaagcgcgatgaattgattgtggatattgaa
accgacaaggtggttttggaagtagtggctccggccgatggtagtattgctgaaattgtt
aaaggcgaaggcgaaaccgtactgagcaacgaagtgattgccaggtttgcggaaggtgcc
gtagctgctgctcccgccgctgcggcgacccctgcagcagaagccaagccagctgcagca
ccggctgaaaaattggttaaccccgccgcgcgcaaactggccgaagaaaacaatgtaaac
actgctgctgtgtccggtaccggcaaagacggtcgtgtgttgaaagaagatgtagccaac
cacctcaagtcagctccggcggcaacacccgcagtagcagcgccggcaccggcaccgatt
gaagctgctggtgagcgtgttgaaaaacgcgtacctatgactcgtttgcgtaaacgcatt
gccgagcggttgctcgaagccagcagtactaccgctatgctcactaccttcaacgaagtg
aacatgaagccggttatggatctgcgtgccaaatacaaagaccagtttgaaaaagtacac
aacggtactcgcctgggctttatgagtttcttcgtgaaagcggccgctgaggccctgcgt
cgtttcccggttgtcaatgcctctatcgataacaacgatattgtttatcacggttatcag
gatattggtgttgccgtatcaaccgataaaggcctggtggtacctgtactgcgcaataca
gagaacatgagcctggcgggtattgaaaatgcgattcgcgatttcggcctgcgcgcccgc
gatggcaagttgggtatcgaggaaatgtctggtggcaccttcactattaccaacggcggt
gtatttggatcactcttgtctacgccgatcctgaacctgccccagtctgccatcctgggt
atgcacaaaatccaggagcgccccatggcagttaatggcaaggtagagatcctgcccatg
atgtacctggcgctgtcctatgatcaccgcctgctggatggtaaagacgctgtgcagttc
ctggtgactatcaaggacttgctggaagatccggcgcgtctgctgctcgaaatctaa

DBGET integrated database retrieval system