KEGG   Cellvibrio japonicus: CJA_2381Help
Entry
CJA_2381          CDS       T00721                                 

Definition
(GenBank) hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
cja  Cellvibrio japonicus
Brite
KEGG Orthology (KO) [BR:cja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cja03009]
    CJA_2381
Enzymes [BR:cja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CJA_2381
Ribosome biogenesis [BR:cja03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CJA_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ACE83488
UniProt: B3PKB3
Position
complement(2725176..2726228)
Genome map
AA seq 350 aa AA seqDB search
MNQLFLHCRPGFEKECAAEITELAAAQGIYGYSKTKDNAAFVVFITQDERGAETLIRQLP
FQSLIFVRQWFAGFGNLSDLPVTDRVSPLLEAARALPKTSDLTGETVDTNEGKALSALVK
KFLLPFGKALDAHKCLDRKSPWRLHLVFLSGTEAYLGVAPVNNSSAWPMGIPRLRLPKSA
PSRATLKLEEAWHHFIPAADWDRRLAPGMRAVDLGAAPGGWTWQLVQRSIYVEAIDNGPM
DKDLLDSGLVTHVLADGFLFEPKKPVDWLVCDIVDKPARVSSMVIKWFSKGHCRQAIFNL
KLPMKQRYMEVQKCRTRILGELGSLGMRAELDFKQLYHDREEVTGYLRVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaattattccttcattgtcgtcccgggtttgaaaaggaatgcgctgctgaaatc
acagagttggctgccgcccagggaatttatggttatagcaagactaaagataatgcggct
tttgtcgtctttatcacccaggatgaacgaggcgctgaaacgctaatacggcagcttccg
ttccagtcattgatttttgtacgtcagtggtttgcgggttttggcaatctgagcgacctg
cctgtaaccgaccgggtaagtccgttgctggaagcggcgcgagcactgccgaaaactagt
gacttaacgggcgaaacagttgataccaacgaaggtaaagcgctgtctgcattggttaaa
aaatttctgcttccttttggtaaggcattggatgcacataaatgcctggatcgcaaaagt
ccgtggcgcttgcacctggtattcctgtcaggtacggaagcttatcttggtgtagccccc
gtcaataacagttcagcctggcctatgggaattccgcgtttgcgccttcccaaatctgcg
cccagtcgggcaacgttgaagctggaagaggcttggcaccattttattcccgctgccgat
tgggatagacgattggcaccgggtatgcgcgcagtggatcttggtgcagcgcccggtggt
tggacatggcagctggtacagcgcagcatctatgtagaagccatcgacaatggccccatg
gacaaagacctgctggattccggattggtgacccatgtgttggccgacggttttttgttt
gaacctaaaaagcctgttgactggttggtgtgcgatatcgtggataagccggcgcgggta
tccagtatggtgatcaaatggtttagcaagggacattgtcgccaagccatttttaatctc
aagttgccgatgaaacagcgctatatggaagtccagaaatgccggacacggatactgggg
gagttgggctcactcggtatgcgggcggagctggatttcaaacagctctaccatgaccgg
gaagaagtgacgggctacctgcgcgtcttttga

DBGET integrated database retrieval system