KEGG   Cellvibrio japonicus: CJA_3010Help
Entry
CJA_3010          CDS       T00721                                 

Gene name
cel5D
Definition
(GenBank) cellulase, putative, cel5D
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
cja  Cellvibrio japonicus
Pathway
cja00500  Starch and sucrose metabolism
cja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CJA_3010 (cel5D)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CJA_3010 (cel5D)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase Glyco_hydro_35 TMEM187
Motif
Other DBs
NCBI-ProteinID: ACE84905
UniProt: B3PD52
Structure
PDB: 

Position
complement(3564891..3566297)
Genome map
AA seq 468 aa AA seqDB search
MPHRGQGCIRNWLLTIKPRSIMNRINTLVFSCLLVVLAGCGSAGGGSSGGASSSIITPSS
SDTSSLSSSASSTSSLSSASSLSSSSSSSSSLSSAGLYPSYNTSPAAPDSTGMQSTAVQL
AGKIRLGWNIGNTMEAIGGETAWGNPMVSNELLKLVKDSGFDAVRIPVAWDQYANQESAE
ISAAWLNRVKQVVQMAIDNELYVLINIHWDGGWLENNITPAKKDENNAKQKAFWEQIATH
LRDFDEHLLFAGTNEPNAENAEQMDVLNSYLQTFVDAVRSTGGKNAYRVLVLQGPVTDIE
KTNELWTHMPADTATDRLMAEVHFYTPYNFALMRQDESWGKQFYYWGEGFLSTTDTERNP
TWGEEATIDQLFDLMKTKFVDQGIPVVLGEFSAMRRTNLTGDALTLHLAGRAYYHKYVTQ
QALARGLLPFYWDNGGNDNFSSGIFNRQQNTVFDQQVLDALLEGAGAQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaccgggggcagggttgcatccgcaattggcttctaacaataaaaccgagatcg
atcatgaacagaatcaataccctggtcttttcctgcctcctggttgtgttggcaggctgt
ggtagcgccggtggcggctccagtggcggcgcctcgtccagcattattactccctcgtcg
tccgacacgtcgagtctttccagcagcgcctcaagtaccagcagcctttcaagcgccagt
agcctaagctccagcagttcgtccagcagcagcctgtcttcagccgggctttatcccagt
tacaacaccagcccggcagcccccgatagcaccggtatgcaaagcacggctgtacagctt
gccggcaagatccgcctggggtggaacatcggcaataccatggaggccatcggcggtgaa
accgcctggggcaatcccatggtgtccaacgagttgctcaaactggtcaaggacagtggt
tttgatgccgtgcgtatcccggtggcctgggaccaatatgccaaccaggaaagcgccgag
ataagtgccgcgtggctcaaccgggtcaagcaggtggtacagatggcaattgataatgag
ctctatgtgcttatcaacatccactgggatggcggctggttggaaaacaacatcaccccg
gctaagaaagatgaaaataacgccaagcaaaaagccttctgggagcagatcgctacccat
ttgcgcgactttgatgaacacctgctctttgccggcactaacgagcccaatgcggaaaat
gccgagcagatggacgtgctgaattcctatctccagacctttgtcgatgcggttcgctca
actggtggcaaaaatgcctaccgtgtgctggtgctacagggaccggtaaccgatattgaa
aaaaccaatgaactctggacgcacatgcccgcggatacggcgacggacaggctcatggcc
gaggtgcatttctataccccctataactttgcgctgatgcgccaggacgaaagctggggc
aagcagttttattattggggtgagggcttcctctccaccaccgacaccgagcgcaaccct
acctggggcgaggaagcaacgattgatcaactcttcgacctgatgaaaaccaagtttgtc
gaccaggggattccggttgtactgggcgagttttctgccatgcgccgcaccaacctcacg
ggcgatgcactcacactgcatttggccgggcgcgcctactaccataagtacgtgacccaa
caagcgctggcgcgtgggctcctgccgttctattgggacaatggcggcaacgacaatttc
agctcgggcatttttaatcgccagcaaaacacagtgttcgaccagcaggtgttggacgcg
ctcctggagggcgcaggagcacaataa

DBGET integrated database retrieval system