KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0689Help
Entry
BN148_0689        CDS       T02302                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
cjb00430  Taurine and hypotaurine metabolism
cjb00620  Pyruvate metabolism
cjb00640  Propanoate metabolism
cjb00680  Methane metabolism
cjb01100  Metabolic pathways
cjb01120  Microbial metabolism in diverse environments
cjb01200  Carbon metabolism
Module
cjb_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cjb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN148_0689 (ackA)
   00640 Propanoate metabolism
    BN148_0689 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BN148_0689 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BN148_0689 (ackA)
Enzymes [BR:cjb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BN148_0689 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: CCK66803
Position
643409..644599
Genome map
AA seq 396 aa AA seqDB search
MKILVLNSGSSSIKFKFFDNKVVKASGLVEKIGEQNSKVVLKNTLNNESFERELTINNHE
EGLSIVNELFKESGILADLNALDGCGHRIVHGGRNLSEHCLVDDYVLKEIDRVSIFAPLH
NPAHLAGIKTMIKAAPSVANAAIFDTAFHRTMPDFAYMYALPYDFYDKHNIRRYGFHGTS
HAYVSSRAAKFLQKDQNELNVISAHLGNGASVCAIEKGKSVDTSMGFTPLEGLVMGTRCG
DLDPAILPFISHLKGLTIEEIDTLMNKKSGVYGICGYNDFRDIEREIEQGNDKARLALDM
FCYRLVKYIGSYFAVLPKTDAIIFTGGIGENDSLVRQKVCERLAHLGIELDFELNKQRIS
GERMINHANSKVKVLVIPTDEELEIARITEELIGKN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttagttttaaattcaggttcttcatcgattaaatttaaattttttgataat
aaagtcgttaaagcgagtggcttagtagagaaaattggagagcaaaattcaaaggttgta
ttaaaaaatactttaaataatgaaagttttgaaagagaattaacaataaataatcacgaa
gaaggccttagtatagttaatgagctttttaaagaatcaggaattttagcagatttaaat
gcgcttgatggctgcggtcatcgtatagttcatgggggaagaaatttaagcgagcattgt
ttagtggatgattatgttcttaaagagatagatagggttagtatttttgctcctttgcat
aatcctgcgcatttagcaggtataaaaacaatgatcaaagctgcacctagtgttgctaat
gcagctatttttgatacagcttttcatcgcactatgcctgattttgcttatatgtatgct
ttgccttatgatttttatgataagcataatattagaagatatggttttcatgggacttct
catgcttatgttagttctagagcggcaaaatttcttcaaaaagatcaaaatgaattaaat
gtcatctctgctcatcttggaaatggtgcaagtgtatgtgctatagaaaaaggtaagagt
gtggatacttctatgggatttactccacttgaagggcttgttatgggaacgcgttgtgga
gatttagatcctgctattttaccttttattagccatcttaagggtttaactatagaagaa
atagatacactgatgaataaaaaaagtggagtatatggaatttgcggttataatgatttt
agagatatagaaagagagatagaacaaggtaatgataaagcacgcttggctcttgatatg
ttttgttatcgtcttgttaaatatataggatcctactttgctgtgttgccaaaaaccgat
gctattatttttacaggtggcataggagaaaatgatagtttggttcgacaaaaagtatgt
gagagattagctcatcttggtatcgagttagattttgaacttaacaaacaaaggatttcg
ggcgaaagaatgataaatcatgcaaattctaaagttaaagtgcttgttattcctacagat
gaagaattagaaatcgctagaattacagaagaacttatcggtaaaaattaa

DBGET integrated database retrieval system