KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_1194Help
Entry
BN148_1194        CDS       T02302                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Brite
KEGG Orthology (KO) [BR:cjb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN148_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_NS4A
Motif
Other DBs
NCBI-ProteinID: CCK67286
Position
1122289..1123815
Genome map
AA seq 508 aa AA seqDB search
MQKDNLIAFVIFIISTIAFVIWGFGYISQHQLILFILASIFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSGIVIFPNSLDPMLFVIIMLAALL
SSGVWIFIATKKGLPVSTTHSIVGGIVGASIMMGLLKFDGIQTLSMVKWSEILRIAISWI
ASPLLGGIVAYIIYSYIDKKILKPSEKLNDDLKNIKKERKKFKEEYFLNLKTKSQEEQIK
ELSAIALDEEEQENNFYRNKMKEFKDQEKDIDIYSILKTHMPIIACIAAAIISAMFLFKG
LNNVSTLDILQNFWIIGIIGTISYVVTFAIVKIVKKTELNKTTDRIFSWFQIFTASSFAF
SHGANDIANAIGPFAAILDVLKNGTINATSPVPFAALAMFGVALVVGLWFLGKEVITTVG
SKLATIRPTTGFSAELGASIVILLATQFGIPVSSTHILIGAILGIGVYNKNANWIMMKPI
GLAWIITLPAAGIMAALVFLGFKLSLGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacaacctcatagcttttgttatttttattatcagtactatcgcatttgtt
atttggggatttggttatatttcgcaacatcaattgattctttttattcttgcttctata
tttggcatttttatggcatttaatataggtggaaatgatgtagccaattcttttggaaca
agcgttggcgcaaaaacagtaaccattaaacaagctttaattatagcagctgtttttgag
ctaagcggggcaatcttcgcaggcgcagaagttactaaaaccatacgcagcggtattgtt
atttttccaaattctttagatcctatgctttttgttatcattatgcttgctgcactttta
agctctggggtttggatttttattgcaaccaagaaaggcttacctgtatcaaccacacac
agtatagttggtgggattgtaggtgctagcattatgatggggcttttaaaatttgatgga
atccaaacactctctatggttaaatggagtgaaattttaagaatagctatttcttggata
gcttctcctcttttagggggtattgtagcttatattatttattcatatattgataagaaa
attttaaaaccatcagaaaaactaaatgatgatttgaaaaatatcaaaaaagaaagaaaa
aaattcaaagaagaatattttttaaatttaaaaacaaaatcccaagaagaacaaatcaaa
gaactttccgctatagctttggatgaagaagaacaagaaaataatttctatagaaataaa
atgaaggaatttaaggatcaagaaaaagatatagatatttactctattttaaaaactcat
atgccaatcattgcttgtattgctgctgctatcatttcggcaatgtttttatttaaaggt
ttaaataatgttagcactttggatattttacaaaacttttggattatcggaattatagga
actataagttatgttgtaacatttgctatagtcaaaatcgttaaaaaaacagaacttaat
aaaactactgatagaattttctcatggtttcaaatatttacagcctctagttttgcattt
tcacacggagccaatgatatagccaatgctataggtccttttgcagcgattttagatgtc
ttaaaaaacggtacaattaacgcgacttctcctgtaccttttgcagctttagctatgttt
ggagttgctctagttgtagggctttggtttttaggtaaagaagtgattactacagtgggt
tcaaaacttgcaaccatacgccctactactggattttctgcagaacttggtgcaagcata
gttatactcttagctacacaatttggaattcctgttagctccacccatatactcataggt
gctatattgggtataggagtgtataataaaaacgcaaattggattatgatgaagcctata
ggattggcttggattatcactttaccagccgctggtattatggcagcacttgtattttta
ggatttaaactatctttaggaatttaa

DBGET integrated database retrieval system