KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100384908Help
Entry
100384908         CDS       T03264                                 

Gene name
ATP7B
Definition
(RefSeq) ATPase copper transporting beta
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100384908 (ATP7B)
Enzymes [BR:cjc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     100384908 (ATP7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD_2 HAD
Motif
Other DBs
NCBI-GeneID: 100384908
NCBI-ProteinID: XP_008989520
Ensembl: ENSCJAG00000008347
Position
1
AA seq 1478 aa AA seqDB search
MTPSHGQNYEVPLKVNFLLFQPFPSRPSAQPQMLSKLSLPTRAWEPAMKKSFAFDNVGYE
GGLDGLGPSSQVTTSTIRILGMTCQSCVKSIEDRISSLKGIVSVKVSVEQGSATVNYVPS
VLSPQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKV
RKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE
RLQSTYPKRLFTSANQNINNSETLGNQGNHVVTLQLRIDGMHCTSCILSIEENIGQLPGI
QSIQVSLENKTAQVQYDPSCTSPVSLQRAIEALPPGNFKVSLPDGAEGCGTDHGPFSCHS
PGFSQRNQVQGTCSTTVIAIAGMTCASCVHSIEGMISQREGVQQISVSLAEGTGTVLYNH
SVISPEELSSAIEDMGFEASVISENCSTNSLGNHSAGNSMVQTIGGVPVSVQEVAPHAGG
LPTIHTPDILAKSPQSTRAVAPQKCFLQIKGMTCASCISTIERNLQNKAGILSVLVALMA
GKAEIKYDPEVVQPLEIAQLIQDLGFEAAVMEDYTGSDGSIELIITGMTCASCVHNIESK
LMRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKM
EIKQWKKSFLCSLVFGIPVMALMIYMLIPSSEPHESMVLDHNIIPGLSILNLIFFILCTF
VQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFD
TPPMLFVFIALGRWLEHLAKVTATSALAKLMSLQAVEATVVTLGEDNLIIREEQVPMELV
QRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGAVLI
KATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFI
DFDVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQN
GILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDMATLPLRKVLAVVGTAEA
SSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHGGHPPSASHL
NEAGSLSKGKDAAPQTFSVLIGNREWLRRNGLTISNDVSDAMTDHEMKGQTAILVAIDGV
LCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSH
KVAKVQELQNKGKKVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDV
VASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVV
LSSLQLKCYKKPELERYEAQVHGRIKPLTASQVSVHIGMDDRRRDSPRATPWDQVSYVSQ
VSLSSLTSDKPSRHSATVDDGGDKWSLLLNDRDEEQYI
NT seq 4437 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgagtcacgggcagaactatgaagttcctctgaaagtcaacttcctgctcttc
cagcctttcccctcccgcccctcggcccagccacagatgttatctaaactttctttgcct
acccgtgcctgggaaccagcaatgaagaagagttttgcttttgacaatgttggctatgaa
ggtggtctggatggcctgggcccttcttctcaggtgacgaccagcacaatcaggatcttg
ggcatgacttgccagtcatgtgtgaagtccattgaggacaggatttccagtttgaaaggc
attgtgagtgttaaggtttctgtggagcaaggcagtgccactgtgaactatgtgccatcg
gttttgagcccacaacaggtttgtcatcaaattggggacatgggcttcgaggccagcatt
gcagaaggaaaggcagcctcctggccctcaaggtccttgcctgcccaggaggctgtggtc
aagctccgggtagagggcatgacctgccagtcctgtgtcagctccattgaaggtaaggtc
cggaaactgcaaggagtagtgagagtcaaagtctcactcagcaaccaagaggctgtcatc
acctatcagccttatctcattcagcctgaagacctcagggaccatgtaaacgacatggga
tttgaggctgccatcaagaacaaagtggctcccttaagcctgggaccaattgatattgag
cggttacaaagcacttacccaaagagacttttcacttctgctaaccagaatattaataat
tctgagaccttggggaaccaaggaaaccatgtggtcaccctccaactgagaatagatgga
atgcactgtacatcttgcatcttgagtattgaagaaaatattggccagctcccagggatt
caaagtattcaagtgtccttggagaacaaaactgcccaagtacagtatgacccttcttgt
accagcccggtgtctctgcagagggctatcgaagcacttccacctgggaactttaaagtt
tctcttcctgatggagcagaagggtgtgggacagatcacgggccttttagttgtcattcc
cctggcttctcccaaagaaaccaggtgcagggcacgtgcagtaccactgtgattgccatt
gctggcatgacctgtgcgtcctgtgtccattccatcgaaggcatgatctcccagcgggaa
ggggtgcagcaaatatcagtctctttggccgaagggactggaacagttctttataatcac
tccgtaattagcccagaagaactcagctctgctatagaagacatgggatttgaggcttca
gtcatttctgaaaactgttccaccaactctcttggaaaccacagtgctgggaattccatg
gtgcaaactataggtggtgtacctgtatctgtgcaggaagtggctccccatgctgggggg
ctccctaccattcataccccggacatcttggcaaagtccccacaatcaaccagagcagtg
gcaccacagaagtgcttcttacagatcaaaggcatgacctgtgcatcctgcatatctacc
atagaaaggaatctgcagaataaagctggtattctctccgtgttggttgccttgatggca
ggaaaggcagagatcaagtatgatccagaggtcgtccagccactcgagatagctcagctc
atccaggacctgggctttgaggctgcagtcatggaggactacacaggctccgatggcagc
attgagctgattatcacagggatgacctgcgcgtcctgtgtccacaacatagagtccaaa
ctcatgaggacaaacggcatcacctatgcctccgttgcccttgccaccagcaaagccctt
gttaagtttgacccagaaattattggtccacgggatattatcaaaattattgaggaaatt
ggctttcatgcttccctggcccagagaaaccccaacgctcatcacttggaccacaagatg
gaaataaagcagtggaagaagtccttcctgtgcagcctggtgtttggcatccctgtcatg
gctttaatgatctatatgctcatacccagcagtgagccccatgagtctatggtcctggac
cacaacatcattccaggactgtccattctaaatctcatcttctttatcctgtgtaccttc
gtccagctcctcggtgggtggtacttctatgttcaggcctacaaatctctgagacacagg
tcagccaacatggacgtgctcatcgtcctggccacaagcattgcctacgtctattctctg
gtcatcctggtggttgctgtggccgagaaggcggagaggagccctgtgacattctttgac
acgccccccatgctcttcgtgttcattgccctggggcggtggctggaacacttggcaaag
gtaacagcaacttcagcccttgccaaactcatgtctctccaagctgtagaagccactgtt
gtgacccttggtgaggacaatttaatcatcagggaggagcaagtccccatggagctggtg
cagcggggcgatatcgtcaaggtggtccccgggggaaagttcccagtggacgggaaagtc
ctggaaggcaataccatggctgatgaatccctcatcacaggtgaagccatgccagtcact
aagaaacccggaagcactgtaattgcagggtctataaatgcacatggtgctgtgctcatt
aaagccacccacgtgggcaatgacaccactttggctcagattgtgaaattggtggaagag
gcccagatgtcaaaggcacccattcagcaactggctgaccggtttagtggatattttgtc
ccatttatcatcatcatgtcaactttgacgttggtggtatggattgtaatcggttttatc
gattttgatgttgttcagaaatactttcctaaccccaacaagcacatctcccagacggag
gtgatcatccggtttgcattccagacgtccatcacagtgctgtgcatcgcctgtccctgt
tccctggggctggccacgcccacagctgtcatggtgggcactggggtggctgcacagaat
ggcatcctcatcaagggaggcaagcccctggagatggcgcacaagataaagactgtgatg
tttgacaagactggcaccattacccatggggtccccagggtcatgcgggtgctcctgctg
ggggacatggccacactgcccctcaggaaggttctggctgtggtggggactgcagaggcc
agcagtgaacaccccttgggcgtggcagtcaccaaatactgtaaagaggaacttggaaca
gagaccttgggatactgcacagacttccaggcagtgccaggctgtggaatcgggtgcaaa
gtcagcaacgtggaaggcatcctggcccacggtggacaccctccgagtgccagtcacctg
aatgaggctggcagcctttccaaaggaaaagatgcagccccccagaccttctctgtgctg
attggaaaccgcgaatggctgaggcgcaacggcttaaccatttccaacgatgtcagtgac
gctatgacagaccacgagatgaaaggacagacggccatcctggtggctattgatggtgtg
ctctgtgggatgattgctatagcagatgctgtcaagcaggaggccgccttggctgtgcac
acgctgcagagcatgggtgtagatgtggttctgatcacgggggacaaccggaagacagcc
agagccattgccacccaggttggcatcaacaaagtctttgcagaggtgctgccttcccac
aaggtggccaaggtccaggagcttcagaacaaagggaagaaagtcgccatggtgggagac
ggggtgaatgactctccggccttggcccaggcagacatgggtgtcgccatcggcactggc
acagatgtggccattgaggcagccgacgtcgtcctcattagaaatgatttgctggatgtg
gtggctagcattcacctttccaagaggactgtccggaggatacgcatcaacctggtcctg
gcactgatttataacctggttgggatacccattgcggcaggtgtcttcatgcccatcggc
attgtgctgcagccctggatgggctcggcagccatggcagcctcctccgtgtctgtggtg
ctctcatccctgcagctcaagtgctataagaagcctgaactggagaggtacgaggcacag
gtgcacggccgcataaagcccctgacggcatcccaggtcagtgtgcacatcggcatggat
gacaggcggagggactcccccagggccacgccatgggaccaggtcagctatgtcagccag
gtgtcgctgtcctccctgacgtctgacaagccatcccggcacagcgctacagtggatgat
ggtggggacaagtggtctctgctcctgaatgacagggatgaggagcagtacatctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392179Help
Entry
100392179         CDS       T03264                                 

Gene name
ATP7A
Definition
(RefSeq) ATPase copper transporting alpha
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100392179 (ATP7A)
Enzymes [BR:cjc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     100392179 (ATP7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD_2
Motif
Other DBs
NCBI-GeneID: 100392179
NCBI-ProteinID: XP_017823933
Ensembl: ENSCJAG00000004052
Position
X
AA seq 1542 aa AA seqDB search
MDPNMGANSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPK
TLQEAIDDMGFDAILHNPDPLPVLTDTLFLTVTASLTLPWDRIQSTLLKTKGVTDIKIYP
QQRTLAVTIIPSVVSANRIRELVPDLSLDTGTLEKKSGACEDHSMAQVGEVTLKMKVEGM
TCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKK
QPKYLKLGAIDVERLKNTALKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESALS
TLQYVSSIVVSLENRSAVVKYNASSITPECLRKAIEDLSPGQYRVSISSEFESTSNSPSS
SSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTIE
YDPLLTSPETLREAIEDMGFDATLSDVNEPLVVIAQPSSETLLLTSTNEFYTKGMTPVQD
KEEAKTSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPTVIQPP
MIAEFIRELGFGATVIENADEGDGVLELVVRGMTCASCVHKIESTLTKHRGILYCSVALA
TNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASHLDHKREIRQWRRSFLVSLFF
CIPVMGLMIYMMVMDHHFATLHHNQTMSKEEMINFHPSMFLERQILPGLSIMNLLSFLLC
VPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPVTF
FDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNFLLSEEQVDVE
LVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSL
LIRALMLEQIPTLSSIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIG
FLNFEIVETYFPGYNRSISRTETILRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGA
QNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLTESNRISQHKILAIVGTA
ESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKDNWKIEDN
NIKNASLVQIDASNEQSSTSSSMIIDAQISNAFNAQQYKVLIGNREEWMIRNGLVINNYV
DDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSK
TARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIG
TGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMP
IGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELPARSQIGQKSPSEISVHVG
IDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSAVTSEPDKHSLLKTQLIRQMLKK
EASLLLSPTHLKQLNTASYSSIIMCAFESSCWSCMHIMGQRE
NT seq 4629 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaatatgggtgcgaattctgttaccatttctgttgagggtatgacttgcaat
tcctgtgtttggactattgagcagcagattggaaaagtgaatggtgtgcatcacattaaa
gtatcactggaagaaaaaaatgcaactattatttatgaccctaaactacagactccaaag
accctacaggaagctattgatgacatgggctttgatgctattctccataatcctgaccct
ctccctgttttaactgacaccttgtttctcactgttactgcttcactgactttgccatgg
gaccgtatccaaagcacattactcaagaccaagggtgtaacagacattaaaatttaccct
cagcaaagaactctagcagtgacaataatcccttctgtagtaagtgccaatcggataaga
gagctggttccggatctcagtttagatactggaacactggagaaaaagtcaggagcttgt
gaagatcatagtatggctcaagttggtgaagtcacgctgaagatgaaagtggaagggatg
acctgccattcgtgtactagcaccattgaaggaaaaattgggaaactgcaaggtgttcag
cgaattaaagtctccctggacaatcaagaagctactattgtttatcaacctcatcttatc
tcagtagaggaaatgaaaaagcagattgaagccatgggctttccagcattcgtcaaaaag
cagcccaagtacctcaaattgggagctattgatgtagagcgtctaaaaaatacagcactt
aaatcttcagaagggtcacagcaaaggagtccatcatatacaaatgattcaacagccact
ttcatcattgatggcatgcattgtaaatcatgtgtgtcaaatattgaaagtgctttatct
acactccagtatgtaagcagcatagtagtttctttagagaataggtctgccgttgtaaag
tataatgcaagctcaatcactccagaatgcctgagaaaagcaatagaggacctatcacca
gggcaatatagagttagtatctcaagtgaatttgagagtacctcaaactctccctccagc
tcatctcttcagaagattcctttgaatgtagttagccagcctctgacacaagaaactgtg
ataaacattgatggcatgacttgtaattcctgtgtgcagtctattgagggtgtcatatca
aaaaagccaggtgtaaaatccatacgagtctcccttgcaaatagcaatgggactattgag
tatgatcctctactaacctctccagaaaccttgagagaagcaatagaagacatgggattt
gatgctaccttgtcagacgtgaatgagccattggttgtaatagctcagccttcatcggaa
acgctgcttttgacttcaactaatgaattttatactaaagggatgacaccagttcaagac
aaggaggaagcaaagacttcatctaaatgttacatacaagtcactggcatgacttgcgct
tcttgtgtagcaaacattgaacggaatttaagacgagaagaaggaatatattccatactt
gtggcactgatggctggcaaggcagaagtaaggtataatcctactgttatacaaccgcca
atgatagcagagttcatccgagagcttggatttggagccactgtgatagaaaatgctgat
gaaggagatggtgttctggaacttgttgtgagaggaatgacgtgtgcctcctgtgtacat
aaaatagagtctactctcactaaacacagagggatcttatactgctctgtggccctggca
accaacaaagcacatattaaatatgaccctgaaattattggtcccagagatattatccat
acaattgaaagcttaggctttgaagcttctttggtcaagaaggatcggtcggcaagtcac
ctagatcataaacgagaaataagacaatggagacggtcttttcttgtgagtctgtttttt
tgtattcctgtaatggggctgatgatatatatgatggttatggaccaccactttgcaact
cttcaccataatcaaaccatgagtaaagaagaaatgatcaactttcatccttccatgttc
ctggagcgccagattctgccaggattgtccattatgaatttgctgtcctttttattgtgt
gtacctgtacagttttttggaggctggtacttctacattcaggcttataaagcactgaag
cacaagacagcaaatatggacgtactgattgtgctggcaaccaccattgcatttgcttac
tctttggttattcttctagttgcaatgtatgagagagccaaagtgaaccctgttactttc
tttgacacacctcctatgctatttgtgtttattgcactaggccgatggctggaacatata
gcaaagggcaaaacatcagaggctcttgcaaaactaatttcgctacaagctacagaagca
actattgtaactcttgattctgataatttcctcctgagtgaagaacaagtggatgtggaa
cttgtacaacgtggagacatcattaaagtggttccaggaggcaaatttccagtggatggt
cgtgttattgaaggacattctatggtagatgagtccctcatcacaggggaggcaatgcct
gtggctaagaaacctggcagcacagtgattgctggttccattaaccagaacgggtcactg
cttatccgtgcactcatgttggagcagataccaaccctttcttcaattgtcaaacttgtg
gaagaggcacaaacatcaaaggctcctatccagcagtttgcagacaaactcagtggctat
tttgttccttttattgtttttgtttccattgccaccctcttggtatggattgtaattgga
tttctgaattttgaaattgtggaaacctactttcctggctacaatagaagtatctcccga
acagaaacgatactacgatttgctttccaagcctctatcacagttctgtgtattgcatgt
ccctgttcactgggactggccactccaactgccgtgatggtgggtacaggagtaggtgct
caaaatggcatactaataaaaggtggagagccattggagatggctcataaggtaaaggta
gtggtatttgataagactggaaccattactcatggaaccccagtagtgaatcaagtaaag
gttctaacggaaagtaacagaatatcacagcataaaatcttggccattgtgggaactgct
gaaagtaacagtgaacaccctctaggagcagcgataaccaaatactgcaaacaggagctg
gacactgaaaccttgggtacctgcatagatttccaggttgtgccaggctgtggtattagc
tgtaaagtcaccaatattgaaggcttgctacataaggataactggaagatagaggacaat
aatattaaaaatgcatccctggttcaaattgatgccagtaatgaacagtcatcaacttcg
tcttccatgattattgatgcccagatctcaaatgcttttaatgctcagcagtataaagtc
ctcattggtaaccgggaggagtggatgattagaaatggtcttgtcattaataactatgta
gatgatttcatgactgaacatgagagaaaaggtcgaactgctgtattagtagcagttgat
gatgagctgtgtggcttgatagccattgcagacacagtgaagcctgaagcagaactggct
gtccatattctgaaatctatgggcttagaagtagttctgatgactggagacaacagtaaa
acagctagatctattgcttctcaggttggcattactaaggtgtttgctgaagttctacct
tctcacaaggttgctaaagtgaagcaacttcaagaggaggggaaacgggtagcaatggtg
ggagatggaatcaatgactccccggctctggcaatggctaatgtgggaattgccattggc
acaggcacagatgtagccattgaagcagctgatgtggttttgataaggaatgatcttctg
gatgtagtggcaagtatcgacttatcaagaaagacagtcaagaggattcgaataaatttt
gtctttgctctaatttataatctggttggaattcccatagctgctggagtttttatgccc
attggtttggttttgcagccctggatgggatctgcagcaatggctgcttcatctgtttct
gtagtactttcttctctcttccttaaactttacaggaaaccaacttatgagaattatgaa
ctgcctgcccggagccagataggacagaagagtccttcagaaatcagcgttcatgttgga
atagatgatacctcaagaaattctcctaaactaggtttgctggaccggattgttaattat
agcagagcctctataaactcactactgtctgataaacgctccctaaacagcgctgttacc
agtgaacctgacaagcattcactcctgaagacacagctgataaggcaaatgttgaaaaaa
gaagcatccctccttctctctcccacacacctcaagcagttgaacacagccagttactct
tccattattatgtgtgcctttgagtcatcctgttggtcttgtatgcatattatgggacag
cgggaatag

DBGET integrated database retrieval system