KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100384924Help
Entry
100384924         CDS       T03264                                 

Gene name
CANX
Definition
(RefSeq) calnexin
  KO
K08054  calnexin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04145  Phagosome
cjc04612  Antigen processing and presentation
cjc04918  Thyroid hormone synthesis
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100384924 (CANX)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100384924 (CANX)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100384924 (CANX)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100384924 (CANX)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100384924 (CANX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100384924 (CANX)
   04131 Membrane trafficking [BR:cjc04131]
    100384924 (CANX)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:cjc04091]
    100384924 (CANX)
Chaperones and folding catalysts [BR:cjc03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   100384924 (CANX)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    100384924 (CANX)
Lectins [BR:cjc04091]
 Calnexin / calreticulin
  100384924 (CANX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin Connexin FAM176 TRAP_alpha MAP17 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 100384924
NCBI-ProteinID: XP_017824861
Ensembl: ENSCJAG00000009989
UniProt: U3BBI3
Position
2
AA seq 592 aa AA seqDB search
MEGKWLLCMLLVLGTAVVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPPSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSDLNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDDEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKC
ESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSAMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaagtggttgctgtgtatgttactggtacttggaactgctgttgttgaggct
catgatggacatgatgatgatgtgattgatattgaggatgaccttgatgatgtcattgaa
gaggtagaagattcaaaaccagataccactgctcctcctccatctcccaaggtcacctac
aaagctccagttccaacaggggaagtatattttgctgattcttttgacagaggaactctg
tcagggtggattttatccaaagccaagaaagatgatactgatgatgaaattgccaaatat
gatggaaagtgggaggtagatgaaatgaaggaatcaaagcttccaggtgataaaggactt
gtattgatgtctcgggccaagcatcatgccatctctgctaaactgaacaaacccttccta
tttgacaccaagcctctcattgttcagtatgaggttaatttccaaaatggaatagaatgt
ggcggtgcctatgtgaaactgctttctaaaacatcagacctcaacctggatcagttccac
gacaagaccccttatacgattatgtttggtccagataaatgtggagaggactataaactg
cacttcatcttccgacacaagaaccccaaaacgggtatttatgaagaaaagcatgctaag
aggccagatgcagatctgaagacctattttactgataagaaaacacatctttacacacta
atcttaaatccagataacagttttgaaatattagtggaccaatctgttgtgaacagtgga
aatctgctaaatgacatgactcctcctgttaatccttcacgtgaaattgaggacccagaa
gaccggaagcctgaggattgggatgaaagaccaaaaatcccagatccagaagctgtcaag
ccagatgactgggatgaagatgcccctgctaagattccagatgacgaggccacaaaaccc
gaaggctggttagacgatgagcccgagtatgtacctgatccagatgcagagaaacctgag
gattgggatgaagacatggatggagaatgggaggctcctcagattgccaaccctaaatgt
gagtcagcccctggatgtggtgtctggcagcgacctatgattgacaaccctaattataaa
ggcaaatggaagcctcctatgattgataatcccagctaccagggaatctggaaacccagg
aaaataccaaatccagatttctttgaagatctggaacctttcagaatgactcctttcagt
gctattggtttggagctgtggtccatgacctctgacattttttttgacaactttatcatt
tgtgctgatcgaagagtagtcgatgattgggccaatgatggatggggcctgaagaaagct
gctgatggagctgctgagccaggtgtagtggggcagatgatcgaggcagctgaagagcgc
ccgtggctatgggtggtgtatattctgactgtagccctgcctgtattcctcgttatcctc
ttctgctgttctggaaagaaacagaccagtgctatggagtataagaagaccgatgcacct
caaccagatgtgaaggaagaggaagaagagaaggaagaggaaaaagacaagggagatgag
gaagaagagggcgaagagaaacttgaagagaaacagaaaagtgatgctgaagaagatggt
ggcactgtcagtcaagaggaggaagacagaaaacctaaagcagaggaggatgaaattttg
aacagatcaccaagaaacagaaagccacgaagagagtga

DBGET integrated database retrieval system