KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385000Help
Entry
100385000         CDS       T03264                                 

Gene name
CD4
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc05166  Human T-cell leukemia virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100385000 (CD4)
   04514 Cell adhesion molecules (CAMs)
    100385000 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100385000 (CD4)
   04612 Antigen processing and presentation
    100385000 (CD4)
   04660 T cell receptor signaling pathway
    100385000 (CD4)
   04658 Th1 and Th2 cell differentiation
    100385000 (CD4)
   04659 Th17 cell differentiation
    100385000 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100385000 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    100385000 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100385000 (CD4)
   05170 Human immunodeficiency virus 1 infection
    100385000 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100385000 (CD4)
CD molecules [BR:cjc04090]
 Proteins
  100385000 (CD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD4-extracel C2-set ig Tcell_CD4_C V-set I-set Ig_3 Ig_2 Receptor_2B4 Herpes_gE
Motif
Other DBs
NCBI-GeneID: 100385000
NCBI-ProteinID: NP_001254701
Ensembl: ENSCJAG00000007635
UniProt: Q8HZT8
Position
9
AA seq 457 aa AA seqDB search
MNGGIPFRHSLLVLQLALLIAVTHGKTVVLGKKGEMVELPCETSLKKKLQFHWKTSNQIK
ILGIQGSFVTKGQSKLANRIDSKQSSWDRGSFPLIIRNVQVEDSETYICEVESKKEEVEL
QVFGLTVNPDTHLLQGQSLTLTLESPPGSSPSVECMSPRGKTIRGMKTLFMSQLEIQDSG
TWKCTVSQHLELVFKINIVVLAFQQASSTVYKKEGEQVEFSFPLAFAAEQLTGSGELCWQ
AERASSSESWITFNLTNQEVCVKLVTQDPKLRMGKKLPFHLTLPQALPQYAGSGNFTLAL
KGKTGKLHQEVKLVVMRATQLQNNLTCEVWGPTSPKLVLSLKLENQEAKVSKREKAVWVL
NPEVGAWQCLLSDSGQVLLESKVEVLPTWSPPVQPMALIVLGGVAGLLVFTGLGIFLCVR
CRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggggaatccctttcaggcactcgctcctggtgctgcaactggcgctactcata
gcagtcactcacggaaagacagtggtgctgggcaaaaaaggggagatggtggagctgccc
tgtgaaacttccctgaagaagaagctacaattccactggaaaacctccaaccagataaag
attctgggaattcagggctccttcgtgactaaaggtcaatccaagctggccaatcgcatt
gactcaaagcaaagctcttgggaccgaggatcctttcccctgatcatcaggaatgttcag
gtagaagactcagagacttacatctgtgaagtggagagcaaaaaggaggaggtggaattg
caggtgttcggattgactgtcaaccctgacacccacctgcttcaggggcagagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtggaatgcatgagtccacggggt
aaaacgatacgggggatgaagacccttttcatgtctcagctggagattcaggatagtggc
acctggaaatgcaccgtctcccagcacctggagctggtgttcaaaataaacatcgtggta
ctggctttccagcaggcctccagcacagtgtataagaaagagggggaacaggtggagttc
tccttcccactcgcctttgcagctgaacagctgacgggcagtggcgagctgtgctggcag
gcggagagggcttcctcctccgagtcctggatcaccttcaacctgacgaaccaggaggtg
tgtgtaaaactggttacccaggaccccaagctcaggatgggcaagaagcttccgtttcac
ctcaccctgccccaggccttgcctcagtatgctggctctggaaacttcaccctggctctt
aaggggaaaacgggaaagttgcatcaggaagtgaaactcgtggtgatgagagcgactcag
ctccagaacaatttgacttgtgaggtgtggggacccacctcccctaagctggtgctgagc
ttgaaactggagaaccaggaggcaaaggtctctaagcgggagaaggcggtgtgggtgctg
aaccctgaggtgggggcgtggcagtgtctgctgagtgactcaggacaggtcctgctggaa
tccaaggtcgaggttctgcccacatggtctcccccggtgcagccaatggccctgattgtg
ctggggggtgtcgcgggccttctggtttttactgggctaggcatattcctctgtgtcaga
tgccggcatcgaaggcgccaagcagagcggatgtctcagatcaagagactcctcagtgag
aagaagacctgccagtgcccccaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system