KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385002Help
Entry
100385002         CDS       T03264                                 

Gene name
MARS
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00450  Selenocompound metabolism
cjc00970  Aminoacyl-tRNA biosynthesis
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100385002 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100385002 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjc01007]
    100385002 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjc03016]
    100385002 (MARS)
Enzymes [BR:cjc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100385002 (MARS)
Amino acid related enzymes [BR:cjc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100385002 (MARS)
Transfer RNA biogenesis [BR:cjc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100385002 (MARS)
 Prokaryotic type
   Other AARSs
    100385002 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 100385002
NCBI-ProteinID: XP_017832047
Ensembl: ENSCJAG00000007249
Position
9
AA seq 665 aa AA seqDB search
SPRHALFSSSFLTRLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRLRQW
NTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHIIHADIYRWFNISFDVFGRTTTPQQT
KITQDIFQRLLARGFVLQDTVEQLRCERCARFLADRFVEGVCPFCGFEEARGDQCDKCGK
LINAVELKKPQCKVCRSCPVVKSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAWFITR
SWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNP
EQVDLYQFMAKDNVPFHGIVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVF
GDMAQDTGIPADIWRFYLLYMRPEGQDSTFSWTDMLLKNNSELLNNLGNFINRAGMFVSK
FFGGYVPEMVLTPDDQRLLAHVTLELRHYHQLLEKVRIRDALRSILTISRHGNQYIQVNE
PWKQIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSILLT
NFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQLEETLDLKAKTSLKPTVAETGT
TAGPQQIQALMDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLAVAEGKPPEAPK
GKKKK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
tcaccccgccatgcactgttctcttcctccttccttaccaggttgcctgtggctggggaa
aggaatgtgcttatcaccagtgctctcccttatgtcaacaatgtcccccaccttgggaac
atcattggttgcgtgctcagtgctgatgtctttgccaggtactctcgcctccgccagtgg
aataccctctatctgtgtgggacagatgagtatggtacagcaacagagaccaaggctatg
gaggagggactgaccccccaggaaatctgtgacaagtaccacatcatccatgctgacatc
taccgctggtttaacatctcgtttgatgtttttggtcgcactactactccacagcagacc
aaaatcacgcaggacattttccagcggttgctggcacgaggttttgtgctgcaagatact
gtggagcaactgcgatgtgagcgctgtgctcgcttcctggctgaccgctttgtggagggc
gtgtgtcccttctgtggctttgaggaggctcggggtgaccagtgtgacaagtgtggcaag
ctcatcaatgctgttgagctgaagaagcctcagtgtaaagtctgccgatcatgccctgtg
gtgaagtcgtctcagcacctgtttctggacctgcctaagctggagaagcgactggaggag
tggttggggaggacattgcctggcagtgactggacacccaatgcctggtttatcacacgt
tcttggcttcgggatggcctcaagccacgctgcataacccgagacctcaaatggggaacc
cctgtacctttagaaggttttgaagacaaggtattctatgtctggtttgatgccactatt
ggctatctgtccatcacagccaactacacagaccagtgggagagatggtggaagaaccca
gagcaagtggacctatatcagttcatggccaaagacaatgttcccttccatggcatagtc
tttccttgttcagccctaggagctgaggataactatactttggtcagccacctcattgct
acagagtacctgaactatgaggatgggaaattctctaagagccggggtgtgggagtgttt
ggggacatggcccaggacacggggatccctgctgacatctggcgcttctatctgctgtac
atgcggcctgagggccaggacagcactttctcctggacggacatgctgctgaagaataat
tctgagctccttaacaacctgggcaacttcatcaacagagccgggatgtttgtgtctaag
ttctttgggggctatgtgcctgagatggtgctcacccctgatgatcagcgcctgctggcc
catgtcaccctggagctccggcactatcaccagctgcttgagaaggttcggatccgggat
gccttgcgcagtatcctcaccatatctcgacatggcaaccaatacattcaggtgaatgag
ccttggaagcagattaaaggcagtgaggctgacaggcaacgggcaggcacagtgactggc
ttggcagtgaatatagctgccttgctctctgtcatgcttcagccttacatgcccacggtt
agtgccacaatccaggcgcagctgcagctcccacctccagcctgtagtatcctgctgaca
aacttcctgtgtaccttaccagcaggacaccagattggcacagtcagtcccttgttccaa
aaattggaaaatgaccagattgaaagtttgaggcagcgctttggagggggccagctagaa
gagaccctcgacttaaaggcaaaaacgtctctgaagccaacagttgcagagactggcaca
acagccgggccccagcagatacaagcactgatggatgaagtgacgaaacagggcaacatt
gttcgagaactgaaagcacaaaaggcagacaagaaccaggttgctgcggaggtggctaaa
ctcttggatctaaagaaacagttggctgtagctgaggggaaaccccctgaagcccctaaa
ggcaagaagaaaaagtaa

DBGET integrated database retrieval system