KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385107Help
Entry
100385107         CDS       T03264                                 

Gene name
MAP3K8
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 8
  KO
K04415  mitogen-activated protein kinase kinase kinase 8 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04668  TNF signaling pathway
Module
cjc_M00688  MAPK (JNK) signaling
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100385107 (MAP3K8)
   04668 TNF signaling pathway
    100385107 (MAP3K8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100385107 (MAP3K8)
   04660 T cell receptor signaling pathway
    100385107 (MAP3K8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100385107 (MAP3K8)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100385107 (MAP3K8)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  Other
   100385107 (MAP3K8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH RIO1
Motif
Other DBs
NCBI-GeneID: 100385107
NCBI-ProteinID: XP_002750186
Ensembl: ENSCJAG00000013285
UniProt: F7FA86
Position
7
AA seq 467 aa AA seqDB search
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTVCQDSNQNDERS
ESLLLSGKEVPWLSSVRYGTVEDLLAFANHISNTAKRFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPV
MRELIEAALERNPNHRPRAGDLLKHEALNPPREDQPRCQSLDSALFERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggagtacatgagcactggaagtgacaataaagaagagattgatttattaattaaacac
ttaaatgtgtccgatgtaatagacattatggaaaacctttatgcaagtgaagagccagca
gtttatgaacccagtctaatgaccgtgtgtcaagacagcaatcaaaatgatgagcgttct
gagtctctgctgcttagtggcaaagaggtaccatggttgtcatcagtcagatacggaact
gtggaggatttgcttgcttttgcaaaccatatatccaacactgcaaagcgtttttatgga
cagcgaccacaagaatctggaattttattaaacatggtcatcactccccaaaatggacgt
taccaaatagattccgatgttctcctgatcccttggaaactgacttacaggaatattggt
tctgattttattcctcggggagcctttggaaaggtatacttggcacaagacataaagaca
aagaaaagaatggcgtgtaaactgatcccagtagatcaatttaagccatctgatgtggaa
atccaggcgtgcttccggcatgagaacattgctgagttgtacggcgcggtcctgtggggt
gaaactgtccatctctttatggaagcaggcgagggagggtctgttctggagaaactggag
agctgtggaccaatgagagaatttgaaattatttgggtgacaaagcatgttctcaaggga
cttgattttctacactcaaagaaagtgatccatcatgatattaaaccaagcaacattgtt
ttcatgtctacaaaagctgttttggtggattttggcctaagcgttcaaatgactgaagat
gtctattttcccaaggacctccgaggaacagagatttacatgagtccggaggtcatccta
tgcaggggccattcaacaaaagcagacatctacagcctgggggccacgctcatccacatg
cagacgggcaccccgccctgggtgaagcgctaccctcgctcagcctatccctcctacctg
tacataatccacaagcaagcgcctccactggaagacatcgcagatgactgtagtccagtg
atgagagagctgatagaagctgccctggagagaaaccccaatcaccgcccaagagccgga
gacctgctaaaacacgaggccctgaacccgcccagagaggatcagcctcgttgccagagt
ctggactctgctctctttgagcgcaagaggctgctgagtaggaaggagctggaacttcct
gagaacattgctgattcttcatgcacgggaagcaccgaggagtctgagatgctcaagcga
cagcgctctctctacatagaccttggcgctctggccggctacttcaatcttgttcgtggg
ccaccaactcttgaatatggctga

DBGET integrated database retrieval system