KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385141Help
Entry
100385141         CDS       T03264                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00051  Fructose and mannose metabolism
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00524  Neomycin, kanamycin and gentamicin biosynthesis
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04066  HIF-1 signaling pathway
cjc04910  Insulin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04973  Carbohydrate digestion and absorption
cjc05230  Central carbon metabolism in cancer
Module
cjc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cjc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100385141 (HKDC1)
   00051 Fructose and mannose metabolism
    100385141 (HKDC1)
   00052 Galactose metabolism
    100385141 (HKDC1)
   00500 Starch and sucrose metabolism
    100385141 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100385141 (HKDC1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100385141 (HKDC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100385141 (HKDC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100385141 (HKDC1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100385141 (HKDC1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100385141 (HKDC1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100385141 (HKDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100385141 (HKDC1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100385141 (HKDC1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100385141 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100385141
NCBI-ProteinID: XP_002807490
Ensembl: ENSCJAG00000012961
Position
12
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFQAEMEKGLAKDMNPTAA
VKMLPTFVRAIPDGSEKGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPSEVIR
GNGTELFEYVADCLADFMKTKGLKHKKLPLGLTFSFPCRQTKLEEGVLISWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPHCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLVLLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANAREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLQENKKVERLRTTVGVDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIEKGWALFRLT
QEQLVDVQAKMRAELEYGLKKKNHTLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLGIMQGTGEELFDHIVQCIADFLDYMGLKGAPLPLGFT
FSFPCRQMSIDKGALIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVALVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNLCYMEDMRNIEMVEGDDGKMCINTEWGGFGDNGCIEDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQELGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAV
VEKRREDQGLEHLKITVGVDGTLYKLHPHFSRILQETVKELAPQCDVTFMLSEDGSGKGA
ALITAVAKRIQQARKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtccacttgatggcattttacttcagcaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgacacccttttggacatcatg
aggcggttccaggccgagatggagaagggactggcgaaggacatgaaccccacggctgca
gtgaagatgctgcccaccttcgtcagggccattcctgatggctcagaaaagggggagttc
ctttccctggatcttggagggtccaagtttcgagtgctgaaggttcaagtcgctgaagag
gggaagcggcacgtgcagatggagagtcagttctacccaacgcccagtgaagtcatccgc
gggaatggcacggagctgtttgaatatgtagctgactgtctggcagatttcatgaagacc
aaaggtttaaagcataagaaattgccccttggcttaactttttctttcccctgccgacag
acgaaattggaagagggtgtcctgatttcatggacaaagaagtttaaggcaagaggagtt
caggacacagatgtggtgagccgtctgaccaaagccatgagaagacacaaggacatggac
gtggacatcctggctctggtcaatgacactgtggggaccatgatgacctgtgcgtatgat
gacccccactgcgaagttggtgtcatcattggaactggcaccaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggccttcggggatgacggggccctggaggacattcgcaccgagttcgacagggag
ctggacctcggctctctcaacccaggaaagcaactgttcgagaagatgatcagtggcctg
tacctgggggagcttgtcaggctcgtcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcctctgctctccacactaagggcaagatcgaaacacggcacgtagct
gccatggagaagtataaagaaggccttgccaatgcaagagagatcctggtggatctgggc
ctggagccgtccgaggccgactgcattgccgtccagcatgtctgcacaatcgtctccttc
cgctccgccaacctctgtgcagcagccctggcggccatcctgacacgccttcaggagaac
aagaaggtggaacggctgcggaccacagtgggcgtggatggcaccctctacaagatccac
cctcagtacccaaaacgcctgcataaggtggtgaggaaactggtcccaagctgtgacgtc
cgcttcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcggtggcc
tcccgcgtgcaggcccagcggaagcagattgagaaggggtgggctttgttccggctgacc
caagagcagctcgtggacgtgcaggccaagatgcgggctgagctggagtacgggctgaag
aagaagaaccacacactggccacggtcaggatgctgcccacctatgtctgcgggctgccg
gacggcacagagaaaggaaagttcctcgccctagatcttgggggaaccaacttccgcgtc
ctcctcgtgaagatcagaagtggacggaggtcagtacgaatgtacaacaagatcttcgcc
attcccctggggatcatgcagggcactggtgaggagctctttgaccacattgtgcagtgc
attgccgacttcctggactacatgggcctcaagggagcccccctacctttgggcttcacg
ttctcatttccctgcaggcagatgagcattgacaagggagcactcatagggtggaccaaa
ggcttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaatgagtttgacttggacattgttgcacttgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacctgtgctacatggaggacatgaggaacattgagatggtggagggggatgacggg
aagatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagaggacatc
cggacccgatacgacacggaggtggacgagggctccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacctgggggagatcgtacggcagatcctgatcgacctg
accaagcagggtctcctcttcagagggcagatttcagagcgtctccggaccaggggcatc
tttgaaaccaagttcctgtcccagatcgaaagcgatcggctggccctcctccaggtcagg
aggattctgcaggagctgggcttggacagcacatgtgaggacagcattgtggtgaaggag
gtgtgcggagctgtgtcccggcgggcagcccagctctgtggtgctggcctggccgccgta
gtggaaaaaaggagagaagaccaggggctggaacacctgaagatcactgtgggtgtggat
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcaatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcgctgatcactgctgtggcgaagagaatacagcaggcacggaaggagaactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396473Help
Entry
100396473         CDS       T03264                                 

Gene name
HK2
Definition
(RefSeq) hexokinase 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00051  Fructose and mannose metabolism
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00524  Neomycin, kanamycin and gentamicin biosynthesis
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04066  HIF-1 signaling pathway
cjc04910  Insulin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04973  Carbohydrate digestion and absorption
cjc05230  Central carbon metabolism in cancer
Module
cjc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cjc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100396473 (HK2)
   00051 Fructose and mannose metabolism
    100396473 (HK2)
   00052 Galactose metabolism
    100396473 (HK2)
   00500 Starch and sucrose metabolism
    100396473 (HK2)
   00520 Amino sugar and nucleotide sugar metabolism
    100396473 (HK2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100396473 (HK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100396473 (HK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100396473 (HK2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100396473 (HK2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100396473 (HK2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100396473 (HK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100396473 (HK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100396473 (HK2)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100396473 (HK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 100396473
NCBI-ProteinID: XP_002757631
Ensembl: ENSCJAG00000017161
UniProt: F7HCY2
Position
14
AA seq 917 aa AA seqDB search
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDDTLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMKNQIYAVPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLKTGLFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTVGVDGSVYKKH
PHFAKCLHKTVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEPLKLS
REQLLEVKRRMKVEMERGLSKETHAIAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD
FRTEFDVAVDELSLNPGKQRYEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDTLKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcgcatctgctcgcctacttcttcacagagctcaaccacgaccaagtgcag
aaggttgaccagtatctctaccacatgcgcctctctgatgataccctgttggagatttct
aagcggttccgcaaggagatggagaaagggcttggagccaccacccaccccactgcagca
gtgaagatgctgcccacctttgtgagatccactccagacgggacagaacacggagagttc
ctggctctggaccttggagggaccaacttccgtgtgctttgggtgaaagtaaccgacaat
gggctccaaaaggtggagatgaagaaccagatctatgccgtccccgaggacatcatgcga
ggcagtggtacccagctgtttgaccacattgccgaatgtctggctaacttcatggataaa
ctacaaatcaaagacaagaagctcccattgggttttaccttttcgttcccttgccaccag
actaaactagacgagagtttcctggtctcatggaccaagggcttcaagtccagtggagtg
gaaggcagagacgttgtggctctgatccggaaggccatccagcggagaggggactttgat
atcgacattgtggctgtggtgaatgacacagttgggaccatgatgacttgtggttatgat
gaccacaactgtgagattggtcttattgtgggcacgggcagcaacgcttgctacatggaa
gagatgcgccacatcgacatggtggagggtgacgaggggcggatgtgtatcaacatggag
tggggggccttcggggatgatggctcgctcaatgacattcgcactgagtttgaccaggag
attgacatgggctcactgaaccctgggaagcaactgtttgagaagatgatcagtggcatg
tacatgggggagctggtgaggcttatcctggtgaagatggccaaggaggagctgctcttt
ggggggaagctcagcccagagctcctcaaaaccggtctctttgagaccaaagacatctca
gacattgaaggggagaaggatggcatccggaaagcccgtgaggtcctgatgcggttgggc
ttggatccgacgcaggaggactgcgtggccactcaccggatctgtcagatcgtgtccaca
cgctcagccagcctgtgcgcagccaccctggccgccgtgctgcagcgcatcaaggagaac
aagggcgaggagcggctgcgctccaccgttggggttgacggctccgtctacaagaaacac
ccccattttgccaagtgtctacacaagaccgtgcggcggctggtgcccgactgtgatgtc
cgcttccttcgctccgaggatggtagtggcaaaggtgcagccatggtgactgcagtggct
taccggctggccgatcaacaccgtgctcgccagaagacactagagcctctgaagctgagc
cgtgagcagctgttggaggtcaaaaggaggatgaaggtagaaatggagcgaggtctgagc
aaggagactcatgccattgcccctgtcaagatgctgcccacctacgtgtgtgccacccct
gacggcacagagaaaggggacttcttggccttggaccttggaggaacaaacttccgggtc
ctgctggtgcgtgttcggaatgggaagtggggcggagtggagatgcacaacaagatctat
gccatcccgcaggaggtcatgcacggcactggggacgagctctttgaccacattgtccag
tgcatcgcggacttcctcgagtacatgggcatgaagggcgtgtccctgcctctgggtttt
actttctccttcccctgccagcagaacagcctggatgagagcatcctccttaagtggaca
aaaggtttcaaggcatctggctgcgagggtgaggacgtggtgaccctgctgaaggaagcg
atccaccggcgagaggagtttgacctggatgtggttgctgtggtgaacgatacagtcgga
actatgatgacctgtggctttgaagaccctcattgtgaagttggcctcattgttggcacg
ggcagcaatgcctgctacatggaggagatgcgcaatgtggaactggtggaaggagaagag
gggcggatgtgtgtgaacatggaatggggggccttcggggacaatggatgcctagatgac
ttccgcacggaatttgatgtggctgtggatgagctttcactcaaccccggcaagcagagg
tacgagaaaatgatcagtggaatgtacctgggtgagattgttcgtaacattctcatcgat
ttcaccaagcgtgggctgctcttccgaggccgcatctcagaacggctcaagacaaggggc
atctttgaaaccaagttcttgtctcagattgagagtgactgcttggccctgctgcaagtc
cgagccatcctgcaacacttgggccttgagagcacctgtgatgacagcatcatcgttaag
gaggtgtgcactgtggtggcccggcgggcagcccagctctgtggtgcaggcatggccgct
gtggtggacaagatacgagaaaaccgagggttggacactctcaaagtgacagtgggtgtg
gatgggacactctacaagctacatcctcactttgccaaagtcatgcatgagacagtgaag
gacctagctccaaaatgtgatgtgtctttcctgcagtcagaagacggcagcgggaagggg
gcggcgctcatcactgctgtggcctgccgtatccgtgaggctggacaacgatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413117Help
Entry
100413117         CDS       T03264                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00051  Fructose and mannose metabolism
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00524  Neomycin, kanamycin and gentamicin biosynthesis
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04066  HIF-1 signaling pathway
cjc04910  Insulin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04973  Carbohydrate digestion and absorption
cjc05230  Central carbon metabolism in cancer
Module
cjc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cjc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100413117 (HK1)
   00051 Fructose and mannose metabolism
    100413117 (HK1)
   00052 Galactose metabolism
    100413117 (HK1)
   00500 Starch and sucrose metabolism
    100413117 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100413117 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100413117 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100413117 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100413117 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100413117 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100413117 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100413117 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100413117 (HK1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100413117 (HK1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100413117 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-GeneID: 100413117
NCBI-ProteinID: XP_009008060
Ensembl: ENSCJAG00000016503
Position
12
AA seq 788 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLVDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVRMESEVYDIPENIVH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCQQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPVEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVDGDQGQMCINMEWGAFGDNGCLDD
IRTNYDRLVDEYSLNAGKTKILWGHFTEGPVLCCAVPWRLRAEQDTHDLSSWGCPCSSGC
GAVGSCVL
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcacagctcctggcctattacttcacggagctgaaggatgaccaagtcaaa
aagattgacaaatatctctatgccatgcggctctctgatgaaactctcgtagatatcatg
actcgcttcaagaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacatttgtaaggtccattcccgatggctctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcgcatggagtctgaggtttatgacatcccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgtcgctgagtgcctgggagatttcatggagaaa
aagaagatcaaggacaagaagttacctgtgggattcacattttcttttccttgccaacaa
tccaaaatagatgaggctgtcctgatcacctggacaaagcgatttaaagcgagcggcgtg
gaaggagcagatgtggtcaagctgcttaacaaagccataaaaaagcgaggggactatgat
gccaacattgtagctgtggtgaatgacacggtgggtaccatgatgacctgtggctatgac
gaccagcagtgcgaagtgggcctgatcatcggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaacacggaa
tggggagcctttggagatgatggatccttagaagacattcggacggagtttgacagggag
atagaccgaggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctggtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgatgtgtca
gccattgaaaagaataaggaaggtctgcacaatgccaaagaaatcctgacccgcctggga
gtggagccatctgatgatgactgtgtttcagtccagcacgtgtgcaccattgtctcattt
cgctcagccaacctggtggctgccacgctgggtgccatcttgaaccgcctgcgtgataac
aagggcacacctaggcttcggaccacagttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgccagactccgatgtg
cgtttcctcctctcggagagtggcagtggcaagggggccgccatggtgacggcggtggcc
taccgcttggctgagcagcaccggcagatagaggagaccctggctcatttccacctcaca
aaggacatgctgctggaggtgaagaagaggatgcgggcggagatggagctgggcctgcgg
aagcagacgcacaacaatgccgtggtcaagatgctgccctccttcgtccggagcacccca
gacgggaccgagaatggcgacttcttggccttggatcttggaggaactaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacagtggaaatgcacaacaagatctat
gccattcctgttgaaatcatgcagggcactggggaagagctgtttgatcacattgtctcc
tgcatctctgacttcctggattacatggggatcaaaggccccaggatgcctctgggcttc
acgttctcatttccctgcaagcagacgagtctggatgcgggaattttgatcacatggaca
aagggttttaaggcaacagactgtgtggggcacgatgtagtcaccttactaagggatgcg
ataaaaaggagagaggaatttgacctggacgtggtggctgtagtcaacgacacggtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggttggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggatggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacaaattatgacagactggtggacgaatattccctaaatgccggcaaaacaaag
atactttgggggcactttactgagggcccagtgctatgctgtgctgtgccctggagactc
agagctgaacaagacacacatgacctgtcctcttggggctgtccctgtagcagtggttgt
ggagcagtgggctcatgtgtgttgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415061Help
Entry
100415061         CDS       T03264                                 

Gene name
HK3
Definition
(RefSeq) hexokinase 3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00051  Fructose and mannose metabolism
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc00520  Amino sugar and nucleotide sugar metabolism
cjc00524  Neomycin, kanamycin and gentamicin biosynthesis
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04066  HIF-1 signaling pathway
cjc04910  Insulin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04973  Carbohydrate digestion and absorption
cjc05230  Central carbon metabolism in cancer
Module
cjc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cjc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100415061 (HK3)
   00051 Fructose and mannose metabolism
    100415061 (HK3)
   00052 Galactose metabolism
    100415061 (HK3)
   00500 Starch and sucrose metabolism
    100415061 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    100415061 (HK3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100415061 (HK3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100415061 (HK3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100415061 (HK3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100415061 (HK3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100415061 (HK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100415061 (HK3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100415061 (HK3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100415061 (HK3)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100415061 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF5473
Motif
Other DBs
NCBI-GeneID: 100415061
NCBI-ProteinID: XP_008988548
Ensembl: ENSCJAG00000007223
Position
2
AA seq 986 aa AA seqDB search
MFGKWWRKRVGFEDNSGHLSVTFWYSVTFGYIGVPHIAREELRPEESDQLLCVPGGQPPL
WKFMDSIGSEGLQQGEEALSCPEEGLPRPSDSSELVQDCLQQFKVTVAQLQQIQASLLGS
MEQALRGQASPFPVVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHR
VEPRSQEFVIPQDVMLGAGQQLFDFAAHCLSEFLDAQPVSKQCLQLGFSFSFPCHQTGLD
RSTLISWTKGFRCSGVEGQDVVQLLRDAIQRQGAYNIDVVAVVNDTVGTMMGCELGARPC
EVGLVVDTGTNVCYMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHE
SLNPGAQRFEKMIGGLYLGELVRLVLAHLTRRGVLFRGCPSPALLSQGSILLEHVAEMED
PSAGAARVHAILQDLGLSPEASDVELVQRVCAAVCMRAAQLCAAALAAVLSRLQHSREQQ
TLQVTVATGGRVCERHPRFCSILQGTVMLLAPECDVSFIPSADGGGRGVAMVTAVAARLA
AHWRLLEETLAPFRLNHDQLAAVQAQMREAMAKGLRGEASSLRMLPTYVRATPDGSERGD
FLALDLGGTNFRVLLVRVTTCVQITSQIYSIPESVAQGSGQQLFDHIVDCIVDFQQKQGL
SGQSLPLGFTFSFPCRQLGLDQGILLNWTKGFNASDCEGQDVVSLLREAIMRRQAVELNV
VAIVNDTVGTMMSCGYEDPHCEIGLIVGTGTNACYMEELRNVAGVPGDSGHMCINMEWGA
FGDDGSLDTLSTCFDTSVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQ
QTQCLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAA
QLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPHFSSLVAATVRELAPRCAVTFL
QSEDGSGKGAALVTAVACRLAQSTHI
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaagtggtggaggaaaagggtggggtttgaggataactcgggtcacctgagt
gtcactttttggtacagtgtcacttttgggtacattggggtgcctcacattgccagagaa
gagctcagacctgaggagagtgaccagcttctgtgtgttccaggtggccagcctccactg
tggaagttcatggactccattgggtctgaagggttgcagcagggtgaagaagccctgagt
tgccctgaggagggcttgccccggccctcagacagctcagagctggtgcaggactgcctg
cagcagttcaaggtaacagtggcacagctgcagcagatccaagccagcctcttgggttcc
atggagcaggcactgaggggacaggccagccctttccctgtggtccggatgctgcctaca
tatgtggggtccaccccacatggcactgagcaaggagacttcgtggtgctggagttgggg
gccacaggggcctcactgcgtgttttatgggtgactctaaccggcattgaggggcatagg
gtggagcccaggagccaggagtttgtgatcccccaagacgtgatgctgggtgccggccag
cagctctttgactttgctgcccactgcctgtctgagttcctggatgctcagcctgtgagc
aaacaatgtctgcagcttggcttcagcttctctttcccttgtcaccagacaggcttggac
aggagcaccctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggccaggat
gtggtccagctgctgagagatgccattcagaggcagggggcctacaacatcgacgtggtt
gccgtggtgaacgacacagtgggtaccatgatgggctgtgagctgggggccaggccgtgt
gaggttgggcttgttgtagacacaggcaccaacgtgtgttacatggaggaggcgcggcac
gtggcagtgctggatgaagaccggggccgcgtctgcgtcagcgtcgaatggggctccttc
agcgatgatggggcactggggccagtgctaaccaccttcgaccacaccctggaccatgag
tccctgaatcctggtgctcagaggtttgagaagatgattgggggcctgtacctgggtgag
ctggtgcggctggtgctggctcacttgacccgacgtggggtcctcttccgtggctgcccc
tcccctgccctgctgagccaaggcagcatcctcctggagcacgtggctgagatggaggac
ccctctgctggggcagcccgtgtccatgctatcctgcaggacttgggcctgagccctgag
gcttcggatgttgagctcgtgcagcgcgtgtgtgcagctgtgtgcatgcgggctgcccag
ctctgtgctgctgcccttgccgctgttctttcccgcctccagcacagccgtgagcaacaa
acactccaggtcactgtggccactggaggccgagtgtgtgagcggcaccccaggttttgc
agcattctgcaggggacagtgatgctcctggccccagagtgcgatgtctccttcatcccc
tctgcggatgggggtggccggggagtagcaatggtgactgctgtggctgctcgactggcc
gcccactggcgcctgctggaagagaccctggccccattccggttgaaccacgatcaactg
gcggcagttcaggcacagatgcgggaggccatggccaaggggctccgaggggaggcatcc
tccctccgcatgctgcccacttacgtcagggccacacctgatggcagcgaacgaggggat
ttcctggctctggacctcgggggcacaaacttccgtgtcctcctggtacgtgtgaccaca
tgtgtgcagatcaccagtcagatctactccatccctgagagtgtggcccagggctctggg
cagcagctctttgaccacattgtggactgcatcgtggacttccagcagaagcagggcctc
agtgggcagagcctacccctgggttttaccttctccttcccatgtaggcagcttggcctg
gatcagggcatcctcctgaactggaccaagggtttcaacgcatcagactgtgagggccaa
gatgttgtgagtctgttgcgggaagccatcatgcgcagacaggcagtggagctgaatgtg
gttgctattgtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccccat
tgcgagataggcctcattgtcggaactggcaccaatgcttgctacatggaggagctccgg
aatgtggcaggagtgcctggggactcaggccacatgtgcatcaacatggagtggggtgcc
tttggggatgatggctctctggacacgctcagcacctgctttgacacaagtgtggaccag
gcgtccatcaaccctggcaagcagaggtttgaaaagatgatcagcggcatgtacctgggg
gagatcgtccgccatatccttttacatttaaccagccttggcgttcttttccggggccag
cagacccagtgccttcagaccagggacatcttcaagaccaagttcctctctgagatcgaa
agcgacagcctggccctgcggcaggtccgagccatcctagaggacctggggctgcccctg
acctcagacgatgccctgatggtgctagaggtctgccaggccgtgtcccagcgggctgcc
cagctctgcggggcgggtgtagctgctgtggtggagaaaatccgggagaaccggggcctg
gaagagctggcagtgtccgtgggggtggatggaacactctacaagctgcacccacacttc
tccagcctggttgcggccacggtgcgggagctggcccctcgctgtgcagtcacgttcctg
cagtcagaggatgggtctggcaaaggtgcggctttggtcactgctgttgcctgccgccta
gcacagtcgactcatatctga

DBGET integrated database retrieval system