KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385191Help
Entry
100385191         CDS       T03264                                 

Gene name
ALDH9A1
Definition
(RefSeq) aldehyde dehydrogenase 9 family member A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100385191 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    100385191 (ALDH9A1)
   00620 Pyruvate metabolism
    100385191 (ALDH9A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100385191 (ALDH9A1)
   00561 Glycerolipid metabolism
    100385191 (ALDH9A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100385191 (ALDH9A1)
   00310 Lysine degradation
    100385191 (ALDH9A1)
   00330 Arginine and proline metabolism
    100385191 (ALDH9A1)
   00340 Histidine metabolism
    100385191 (ALDH9A1)
   00380 Tryptophan metabolism
    100385191 (ALDH9A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100385191 (ALDH9A1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100385191 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     100385191 (ALDH9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 100385191
NCBI-ProteinID: XP_002760484
Ensembl: ENSCJAG00000004575
UniProt: U3CQG4
Position
18
AA seq 518 aa AA seqDB search
MFFRAGRAAVSSFLRSVLQSPVATMSTGTFVVSQPLNYRGGTRVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIRERKDEIATVEC
INNGKSIFEARLDIDTSWQCLEYFAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYTEAGVPPGLFNVVQGGVATG
QFLCQHHDVAKVSFTGSVPTGMKIMEMASKGVKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDTYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILPFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtttttccgagcgggccgggctgcggtttcttcgtttcttcgcagtgttctgcagtct
cctgtggccaccatgagcaccggcaccttcgttgtgtcgcagccgcttaattaccgtggc
gggacccgcgtggagccggcggacgcctctggcacggagaaggctttcgagccggcaacc
ggccgagtgatagctactttcacatgttcaggagaaaaggaagtaaatttggctgttcag
aatgcaaaggctgcttttaaaatatggagtcaaaaatctggcatggagcgttgccgaatc
cttttggaggctgccagaataataagggaacggaaggatgaaattgccactgtggaatgc
atcaacaacggcaagtccatctttgaggcccgcttggacattgacacttcctggcagtgc
ctggagtattttgcgggcttggctgcgtccatggctggtgaacacatccagctcccaggc
ggatcctttggttataccagaagagaaccacttggggtatgtgtgggaataggagcgtgg
aactacccctttcagatcgcttcttggaagtcagctcctgcgttagcctgtggtaatgcc
atggtcttcaaaccttctccctttacgcctgtttctgcgttgttactggctgaaatctac
actgaagctggtgtgcctcctgggctcttcaatgtggtgcagggcggggttgccactggc
cagtttctgtgtcagcatcatgatgtggccaaagtctccttcactggaagtgtgcccact
ggcatgaagatcatggagatggcatctaaaggagtcaaacctgttaccttggaacttgga
ggcaaatctccactcatcatcttctcagactgtgatatgaacaacgctgtgaagggggcg
ctgatggccaacttcctcacacaaggccaggtttgctgtaatggcacaagagtatttgtg
cagaaagaaattcttgataaatttacagaggaagtggtgaaacagactcaaaggattaaa
attggagatccccttctggaagacacaaggatgggtccactcatcaaccgaccacacctg
gagcgagtccttgggtttgttaaagtggcaaaggagcagggtgctaaagtgttatgtggt
ggagatacatatgtacctgaagatcctaaattaaaggatggatattacatgagaccttgt
gtattaactaattgcagagatgacatgacctgtgtgaaagaagagatctttgggcctgtt
atgtctattttaccatttgacactgaagctgaggttctagaaagagccaatgataccact
tttggactagcagctggcgtctttaccagggacatccagcgggctcatagagtggtagct
gagcttcaggctggaacctgcttcattaacaactataacgtcagcccagtggagttgccc
tttggtggatataagaagtcaggatttggcagagagaacggccgtgtgacaattgaatat
tattcacaactgaagactgtgtgtgtggagatgggtgatgtggaatccgctttttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388478Help
Entry
100388478         CDS       T03264                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100388478 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100388478 (ALDH2)
   00620 Pyruvate metabolism
    100388478 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100388478 (ALDH2)
   00561 Glycerolipid metabolism
    100388478 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100388478 (ALDH2)
   00310 Lysine degradation
    100388478 (ALDH2)
   00330 Arginine and proline metabolism
    100388478 (ALDH2)
   00340 Histidine metabolism
    100388478 (ALDH2)
   00380 Tryptophan metabolism
    100388478 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100388478 (ALDH2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100388478 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 100388478
NCBI-ProteinID: XP_009002916
Ensembl: ENSCJAG00000011989
UniProt: F7ATY6
Position
9
AA seq 517 aa AA seqDB search
MLRAAARLGPRLGHRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSGKTFPTVNPS
TGEIICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTETGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVDRSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINSGKQEGAKLLCGGGVAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTMEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgccgcccgcctcgggcctcgcctgggccaccgcctcttgtccgccgct
gccacccaggctgtgcccgcccccaaccagcagcccgaggtgttctgcaaccagatcttc
ataaacaatgaatggcatgatgctgtcagcgggaaaacattccccacggtcaatccgtcc
actggagagatcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggctgcccgggctgccttccagctaggctcaccatggcgccgcatggatgcatcacac
aggggccggctgctgaatcgcctggctgatctgatcgagcgggaccgcacctacctggca
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctcaggtattatgccggatgggctgataagtaccacgggaaaacc
attcctattgatggagacttcttcagctacacccgccatgaacctgtgggggtgtgtggg
cagatcattccgtggaattttccacttctgatgcaagcgtggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacaccccttaccgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggttaacattgttcctgga
tttggccctactgctggggctgctattgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagactggccgcctaatccaggtagctgccgggagtagcaacctcaag
agagtgaccctggagctaggggggaagagccccaatatcatcatgtcagatgccgacatg
gactgggcggtggagcaggcccactttgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaagaggatatctacgatgagtttgtggatcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagtaagaccgagcaggggcca
caggtggatgaaactcagttcaagaagatcctcggctacattaactctgggaaacaagaa
ggggcaaagctgctgtgtggtgggggcgttgctgccgaccgtggctactttatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagattctgaagttcaagaccatggaggaagttgtcgggagagccaacaattcc
acgtacgggctggctgcggctgtcttcacaaaggacttggacaaggccaattacctgtcc
caggccctccaggcaggcaccgtgtgggtcaactgctatgatgtgtttggcgcccagtca
ccctttggcggctacaaaatgtcagggagtggccgggagctgggcgagtatggccttcag
gcatacaccgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396105Help
Entry
100396105         CDS       T03264                                 

Gene name
ALDH1B1
Definition
(RefSeq) aldehyde dehydrogenase 1 family member B1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100396105 (ALDH1B1)
   00053 Ascorbate and aldarate metabolism
    100396105 (ALDH1B1)
   00620 Pyruvate metabolism
    100396105 (ALDH1B1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100396105 (ALDH1B1)
   00561 Glycerolipid metabolism
    100396105 (ALDH1B1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100396105 (ALDH1B1)
   00310 Lysine degradation
    100396105 (ALDH1B1)
   00330 Arginine and proline metabolism
    100396105 (ALDH1B1)
   00340 Histidine metabolism
    100396105 (ALDH1B1)
   00380 Tryptophan metabolism
    100396105 (ALDH1B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100396105 (ALDH1B1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100396105 (ALDH1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100396105
NCBI-ProteinID: XP_008998006
Position
1
AA seq 517 aa AA seqDB search
MLRFLAPRLLCLQVRTAQYSSAAALPSPIPNPDIRYNQLFINNEWHDAVSKKTFPTVNPS
TGELIGHVAEGDRADVDRAVKAAREAFRLGSPWRQMDASERGRLLNRLADLVERDRVYLA
SLETLDNEKPFQSXXXXXXDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEASIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttcctggcaccccggctgctttgtcttcaggtcaggacggcccagtactcc
tcggcagcagctctcccaagccccatcccgaacccagacatccgctacaaccagctgttc
atcaacaacgagtggcatgatgcagtcagcaagaagaccttcccgacggtcaaccccagc
actggggagctcatcgggcacgtggctgaaggtgaccgggctgatgtggatcgggccgtg
aaagcagcccgggaggccttccgcctggggtccccgtggcgccagatggatgcctctgag
cggggccggctgctgaaccgcctggcagacctagtggagcgggatcgagtctacttggcc
tcactggagaccttggacaatgagaagcctttccagagtnnnnnnnnnnnnnnnntggat
gaggtcatcaaggtgtaccggtactttgctggctgggctgacaagtggcacggcaagacc
atccccatggatggcgagcatttctgcttcacccggcatgagcccgttggtgtctgtggc
cagatcatcccgtggaacttccccttggtcatgcagggttggaagctcgccccagcactc
gccacaggcaacactgtggttatgaaggtggcagagcagacccccctctctgccctatac
ttggcctccctcatcaaggaggcaggttttccccctggggtggtgaacatcatcacaggc
tacggcccaacagcaggtgcggccatcgcgcagcacatggatgtggacaaagttgccttc
actggttccaccgaggtgggtcacctgatccagaaagcagctggtgattccaacctcaag
agagtcaccctggagctgggtggcaagagccccagcatcgtgctggctgacgctgacatg
gagcatgctgtagagcagtgccacgaagccctgttcttcaacatgggccagtgctgctgt
gctggctcccggactttcgtggaagcatccatctacaatgagtttctcgagagaactgta
gagaaagcaaagcagaggaaagtagggaacccctttgagctggacacccagcaggggccc
caggtggacaaggagcagtttgaacgagtcctaggctacatccagcttggccagaaggag
ggtgcaaaactcctctgtggcggagagcgtttcggggagcgtggtttcttcatcaagcct
actgtctttggtggcgtgcaggatgacatgaggattgccaaagaggagatctttgggcct
gtgcagcccctgttcaagttcaagaagattgaggaggtgattgagagggccaacaacacc
agatatggcctggctgcggctgttttcacccgggacctggacaaggccatgtacttcacc
caggcactccaggctgggaccgtgtgggtaaacacctacaacattgtcacctgccacacg
ccatttggagggtttaaggaatctggaaacgggagggagctgggtgaggatgggcttaag
gcctacacggaggtgaagacggtcactatcaaggttcctcagaagaactcgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401828Help
Entry
100401828         CDS       T03264                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00260  Glycine, serine and threonine metabolism
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100401828 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    100401828 (ALDH7A1)
   00620 Pyruvate metabolism
    100401828 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100401828 (ALDH7A1)
   00561 Glycerolipid metabolism
    100401828 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100401828 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    100401828 (ALDH7A1)
   00310 Lysine degradation
    100401828 (ALDH7A1)
   00330 Arginine and proline metabolism
    100401828 (ALDH7A1)
   00340 Histidine metabolism
    100401828 (ALDH7A1)
   00380 Tryptophan metabolism
    100401828 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100401828 (ALDH7A1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100401828 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100401828 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100401828 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100401828
NCBI-ProteinID: XP_008989852
Ensembl: ENSCJAG00000011102
Position
2
AA seq 574 aa AA seqDB search
MGSPGCGAGLYFSSFPGLRLTLRSGLSMWRLPRALCVQAVKTSKLPGPWSRPAAFMSTLL
INQPQYAWLKELGLGEENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEDTVK
KAREAWKIWADIPAPKRGEIVRQIGNALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDI
CDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIALICGN
VCLWKGAPTTSLISVAVTKIIAKVLEDNRLPGAICSLTCGGADIGTAMAKDERVNLLSFT
GSTPVGKQVALMVQERFGRSLLEVGGNNAIIAFEDADLNLVVPSALFAAVGTAGQRCTTA
RRLFVHESIHDEVXNRLKKACTQIRVGNPWDYDLPFLSPANVLYGPPHTKQAVSMFLGAV
EEAKKESGTEVYGGKVMDRPGNYVEPTMVTGLGHDASIAHTETFAPILYVFKFKNEEEVF
AWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGTGKHTGGG
RESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcccgggtgcggggcggggctctatttcagcagctttccaggcctcaggctc
accctgcgttctgggctcagtatgtggcgcctcccccgcgcgctgtgtgtgcaagccgta
aagaccagcaagctccccggaccttggagcaggcctgccgccttcatgtccactctcctg
atcaatcagccccagtatgcgtggctgaaagagctgggcctcggagaggaaaacgagggc
gtgtataatggaagctggggaggccggggagaggttattacgacttactgtcctgctaac
aacgagcctatagcaagagtccgtcaggccagtgtggcagactatgaagacactgtaaag
aaagcaagagaagcatggaaaatctgggcagatattcctgctccaaaacgaggagaaata
gtaagacagattggcaatgccttgcgggagaagatccaagtactaggaagcttggtgtct
ttggagatgggaaaaatcttagtggaaggtgtgggagaagttcaggagtatgtggatatc
tgtgactatgctgttggtttatcacggatgattggaggacctatcttgccttctgaaaga
cctggccacgctctgatcgagcagtggaatcctgtaggcctggttggaatcatcacggca
ttcaatttccctgtggcagtgtatggctggaacaacgccatcgccttgatctgtggaaat
gtctgcctctggaaaggagctccaacaacttccctgattagtgtggctgtcacaaagata
atagccaaggttttggaggacaacaggctgcctggggcaatttgttccttgacttgtggt
ggagcagatattggcacagcaatggccaaagatgaacgagtgaacctgctgtccttcact
gggagcactccggtgggaaaacaggtggccctgatggtgcaggagaggtttgggagaagt
ttgttggaagttggaggaaataatgctattattgccttcgaagatgcagacctcaactta
gttgttccatcagctctcttcgctgctgtgggaacagctggccagaggtgtaccactgcg
aggcgactgtttgtgcatgaaagcatccatgatgaggtcngaaacagacttaaaaaggcc
tgtacacagatccgagttgggaacccgtgggactatgaccttccttttctctctccagct
aatgttctctatgggccaccccacactaaacaggcagtgagcatgtttcttggagcagtg
gaagaagcaaagaaagaaagtggcacagaggtctatgggggcaaggttatggatcgccct
ggaaattatgtagaaccgacaatggtgacgggtcttggccacgatgcatccattgcacac
acagagacttttgctccgattctctatgtctttaaattcaagaatgaagaagaggtcttt
gcatggaataatgaagtaaaacagggactttcaagtagcatctttaccaaagatctgggc
agaatcttccgctggctcggacctaaaggatcagactgtggcattgtaaatgtcaacatt
ccaacaagtggggctgagattggaggtgcctttggtacaggaaagcacactggtggtggc
agggagtctggcagtgatgcctggaaacagtacatgagaaggtctacttgtactatcaac
tacagtaaggaccttcctttggcccaaggaatcaagtttcagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410565Help
Entry
100410565         CDS       T03264                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00260  Glycine, serine and threonine metabolism
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100410565 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    100410565 (ALDH7A1)
   00620 Pyruvate metabolism
    100410565 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100410565 (ALDH7A1)
   00561 Glycerolipid metabolism
    100410565 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100410565 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    100410565 (ALDH7A1)
   00310 Lysine degradation
    100410565 (ALDH7A1)
   00330 Arginine and proline metabolism
    100410565 (ALDH7A1)
   00340 Histidine metabolism
    100410565 (ALDH7A1)
   00380 Tryptophan metabolism
    100410565 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100410565 (ALDH7A1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100410565 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100410565 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100410565 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 100410565
NCBI-ProteinID: XP_002763579
Ensembl: ENSCJAG00000009199
UniProt: U3CMP5
Position
2
AA seq 539 aa AA seqDB search
MWRLPRALCVQAVKTSKLPGPWSRPAAFMSTLLINQPQYAWLKELGLGEENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEDTVKKAREAWKIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIALICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NRLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLNLVVPSALFAAVGTAGQRCTTARRLFVHESIHDEVVNRLKKAYSQIRVG
NPWDSNVLYGPLHTKQAVGMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcctcccccgcgcgctgtgtgtgcaagccgtaaagaccagcaagctccccgga
ccttggagcaggcctgccgccttcatgtccactctcctgatcaatcagccccagtatgcg
tggctgaaagagctgggcctcggagaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggttattacgacttactgtcctgctaacaacgagcctatagcaagagtc
cgtcaggccagtgtggcagactatgaagacactgtaaagaaagcaagagaagcatggaaa
atctgggcagatattcctgctccaaaacgaggagaaatagtaagacagattggcgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtctttggagatgggaaaaatctta
gtggaaggtgtgggagaagttcaggagtatgtggatatctgtgactatgctgttggttta
tcacggatgattggaggacctatcttgccttctgaaagacctggccacgctctgatcgag
cagtggaatcctgtaggcctggttggaatcatcacggcattcaatttccctgtggcagtg
tatggctggaacaacgccatcgccttgatctgtggaaatgtctgcctctggaaaggagct
ccaacaacttccctgattagtgtggctgtcacaaagataatagccaaggttttggaggac
aacaggctgcctggggcaatttgttccttgacttgtggtggagcagatattggcacagca
atggccaaagatgaacgagtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caggtggccctgatggtgcaggagaggtttgggagaagtttgttggaacttggaggaaat
aatgctattattgccttcgaagatgcagacctcaatttagttgttccatcagctctcttc
gctgctgtgggaacagctggccagaggtgtaccactgcgaggcgactgtttgtgcatgaa
agcatccacgatgaggtcgtaaacagactgaaaaaggcctattcacagatccgagttggg
aacccatgggactctaatgttctctatgggccactccacactaaacaggcagtgggcatg
tttcttggagcagtggaagaagcaaagaaagaaggtggcacagtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaaccgacaattgtgacgggtcttggccatgat
gcatccattgcacacacagagacttttgctccgattctctatgtctttaaattcaagaat
gaagaagaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaagatctgggcagaatcttccgctggctcggacctaaaggatcagactgtggcatt
gtaaatgtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaag
cacactggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaaggtct
acttgtactatcaactacagtaaggaccttcctttggcccaaggaatcaagtttcagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411274Help
Entry
100411274         CDS       T03264                                 

Gene name
ALDH3A2
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100411274 (ALDH3A2)
   00053 Ascorbate and aldarate metabolism
    100411274 (ALDH3A2)
   00620 Pyruvate metabolism
    100411274 (ALDH3A2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100411274 (ALDH3A2)
   00561 Glycerolipid metabolism
    100411274 (ALDH3A2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100411274 (ALDH3A2)
   00310 Lysine degradation
    100411274 (ALDH3A2)
   00330 Arginine and proline metabolism
    100411274 (ALDH3A2)
   00340 Histidine metabolism
    100411274 (ALDH3A2)
   00380 Tryptophan metabolism
    100411274 (ALDH3A2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100411274 (ALDH3A2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100411274 (ALDH3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 100411274
NCBI-ProteinID: XP_008995002
Ensembl: ENSCJAG00000011685
Position
5
AA seq 527 aa AA seqDB search
MWSRPSASVPRFSCVLDPAMEHEVQRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDI
LAAIGSDLCKSEFNAYSQEVIAVLGEIDFMLENLPEWITAKPVKKNLLTMLDEAYLQPQP
LGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTATILAKLLPQYLDQDLYI
VINGGVEETTELLKQRFDHILYTGNTTVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCD
LDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVQKIKETVKEFYGENVKESPDYER
IINHRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPVLPIVP
VKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFMLNSFPFGG
VGSSGMGAYHGKHTFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVYWGKFFLLKRFNK
EKLGLLLLTFLGIVAAVLVKKYQAVLRRKALLIFLIVHRLRWSSKQR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcaggcccagtgcttctgtaccacggttctcctgtgtgctggacccggccatg
gagcacgaagtccagcgagtccgccaggcgttcctatccggccggtcacgacccttgcgg
ttccggctgcagcagctggaggccctgcggaggatggtgcaggagcgcgagaaggacatc
ctggcggccatcggctccgatctgtgcaagagcgaattcaatgcatacagtcaggaagtc
attgctgtccttggggaaattgattttatgcttgaaaatcttcctgaatggattactgct
aaaccagttaagaagaacctgctcaccatgctggatgaggcctatcttcagccacagcct
ctaggagttgtgctgataatcggagcttggaactacccctttgttctcaccattcagcca
ctgataggagccattgctgcaggaaatgctgtgattatcaagccttctgaactgagtgaa
aatacagccacaatcttggctaagcttctgcctcagtatttagaccaggacctctatatt
gttattaatggtggtgttgaggaaaccacagagctcctgaagcagcgatttgaccacatt
ctctatacgggaaacactacagtcgggaaaattgtcatggaagctgctgccaagcatctg
acccctgtgactcttgaactgggagggaaaagtccatgttatattgacaaagactgtgac
ctggacattgtttgcagacgtataacctggggaaaatacatgaattgtggccaaacgtgc
attgcccccgactacattctctgtgaagcatccctccagaatcaaattgtgcagaagatt
aaagaaacggtgaaggaattttatggagaaaatgtaaaagagtctcctgattatgaaagg
atcatcaatcatcgtcattttaagaggatactaagtttgcttgaaggacaaaagatagct
tttggtggggagacagatgaggccacacgctacatagccccaacagtacttactgatgtt
gatcctaaaaccaaagtgatgcaagaagaaatttttggaccagttcttccaatagtgcct
gtgaaaaatgtagatgaggccataaatttcataaatgaacgtgaaaagcctctggctctc
tacgtattttcacataaccataagctcatcaaacggatgattgatgagacatccagtgga
ggtgtcacaggcaatgatgtcatcatgcacttcatgctcaactctttcccctttggagga
gtgggttccagtggaatgggagcttatcatggaaaacatactttcgatactttttctcat
cagcgtccctgtttattaaaaagtttaaagagagaaggtgctaacaaactcagatatcct
cccaacagccagtcaaaggtgtactggggaaaattttttctcttgaaacggttcaacaaa
gaaaaactcggtctcctgttgctcactttcctgggtattgtagcagctgtgcttgtcaag
aaataccaagctgtgctgaggagaaaggccctgttgatttttctgatagttcacagactg
cgttggtccagtaaacagagatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103790723Help
Entry
103790723         CDS       T03264                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase-like
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00260  Glycine, serine and threonine metabolism
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103790723
   00053 Ascorbate and aldarate metabolism
    103790723
   00620 Pyruvate metabolism
    103790723
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103790723
   00561 Glycerolipid metabolism
    103790723
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103790723
   00280 Valine, leucine and isoleucine degradation
    103790723
   00310 Lysine degradation
    103790723
   00330 Arginine and proline metabolism
    103790723
   00340 Histidine metabolism
    103790723
   00380 Tryptophan metabolism
    103790723
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103790723
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103790723
    1.2.1.8  betaine-aldehyde dehydrogenase
     103790723
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     103790723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103790723
NCBI-ProteinID: XP_008988929
Position
22
AA seq 78 aa AA seqDB search
MQSSYEDQRHNEYHCDLQGPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIALISGNV
CLWNETPTTSLISVAVIK
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgcagagttcctacgaggatcagaggcataatgaatatcattgtgatttacaaggacct
ggtcacgccctgatcgagcagtggaatcctgtaggcctggttggaatcatcacggcattc
aatttccctgtggcagtgtatggctggaacaacgccatcgccttgatcagtggaaatgtc
tgcctctggaacgaaactccaacaacttccctgattagtgtggctgtcataaagtaa

DBGET integrated database retrieval system