KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385251Help
Entry
100385251         CDS       T03264                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00970  Aminoacyl-tRNA biosynthesis
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100385251 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100385251 (GATC)
Enzymes [BR:cjc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100385251 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100385251 (GATC)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100385251 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 100385251
NCBI-ProteinID: XP_002753132
Ensembl: ENSCJAG00000001183
UniProt: U3BJ92
Position
9
AA seq 136 aa AA seqDB search
MLARALWLGLRVPLGGPRGFTSKTDPQGSGRITAEVIEHLERLALVDFGSREAVARLEKA
IAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPG
NIPLPKLDEQEPFPHS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgcgggcgttgtggctgggccttcgggtcccgctgggcgggccccggggcttc
acctccaagacagatcctcagggcagtggccgaatcacggccgaggtgatcgagcacctg
gagcgtctagcccttgtggacttcggcagccgggaggcagtagcgcggctggaaaaagcc
atcgccttcgccgaccggctacgcgcggtggataccgatggggtggagcccatggagtcg
gtcctggaggacagatgtctatacctgagatccgacaatgtagtagaaggcaactgtgct
gatgaattactacaaaactcccatcgtgtcgtggaggagtactttgtggcccctccaggt
aatatccctttgccaaagctggatgaacaagagccattcccacacagctga

DBGET integrated database retrieval system