KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385357Help
Entry
100385357         CDS       T03264                                 

Gene name
VCAM1
Definition
(RefSeq) vascular cell adhesion molecule 1
  KO
K06527  vascular cell adhesion molecule 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100385357 (VCAM1)
   04668 TNF signaling pathway
    100385357 (VCAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100385357 (VCAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100385357 (VCAM1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100385357 (VCAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100385357 (VCAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100385357 (VCAM1)
   05143 African trypanosomiasis
    100385357 (VCAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100385357 (VCAM1)
   04091 Lectins [BR:cjc04091]
    100385357 (VCAM1)
CD molecules [BR:cjc04090]
 Proteins
  100385357 (VCAM1)
Lectins [BR:cjc04091]
 I-type lectins (Siglecs)
  100385357 (VCAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set ICAM_N Ig_4 C2-set_2 Ig_6 Ig_5
Motif
Other DBs
NCBI-GeneID: 100385357
NCBI-ProteinID: XP_003733550
Ensembl: ENSCJAG00000003455
UniProt: A0A2R8MDI5
Position
7
AA seq 739 aa AA seqDB search
MPGKMIVIVGASNILWIMFAVSLAFKIKTTPESRSLAQIGDSVSLTCSTTGCDSPSFSWR
TQIDSPLNGKVRNEGTTSTLTMNPVSFGNEHSYLCTAICGSSKLEKGIQVEIYSFPKDPE
IYLSGPLEAGKPITVKCLVPDVYPFDRLEMSLLKGDHLMKNQEFLEDLDTKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTERKAIKELQIYISPKNTVISVNPSTRLQEGG
SVTMTCSSEGLPPPEIFWSKKLDNGNLQHLSGNATLTLIAMRREDSGIYVCEGVNLIGKD
RKEVELIVQEKPFTVEISPGPRIAARIGDSVVLTCGVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGRKKVEKGIQVELYSFPRDPEIEMSGLLVSGSP
VTVSCKIPGVYPLDRLEIELFKGETILKNKEFLEDMDMKSLETKSLEMTFVPTIEDNGKV
LVCQAKLHVEEMEFEPKQRQTTQTLYVNVAPRNTTISVRPSSILEEGSSVNMTCSSHGLP
APKILWSRQLHNGELQPLSENATLILISTKTEDSGVYVCEGINQAGRSREDVELIIQGSP
KDIQLIAFPSESVREGDTVIISCTCGNVPETWIILKKKAETGDRVLKSIDGAYTIRKAQL
EDAGVYECESKNKVGSQLRSLTLDVQGKENNKDYFSPELLMLYCASSLIIPVIGMIIYFA
RRANMKGSYSLVEAQKSKV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagatgatcgtgatcgttggagcctcaaatatactttggataatgtttgca
gtttctctagcttttaaaatcaagaccacccctgaatctagatctcttgctcagattggt
gactccgtctcactgacttgcagcaccacaggctgtgactctccatctttctcttggaga
acccagatagatagtccattgaatgggaaggtgaggaatgaggggaccacgtctacgctg
accatgaatcctgttagtttcgggaatgaacactcttacctgtgcacagcaatttgcgga
tctagcaaactggaaaaaggaatccaggtggagatctattcttttcctaaggatccagag
atttatttgagtggccctctggaggctgggaagccgatcacagtcaagtgtttggtccct
gatgtatacccatttgacaggctggagatgagcttactgaaaggagatcacctcatgaag
aatcaggaatttctggaggatctagacacgaagtccctggaaacaaagagtttggaagta
acctttactcctgtcattgaggatattggaaaagttcttgtgtgccgagctaaattacac
attgatgaaatggattctgtgcccacagaaaggaaggctataaaagaattgcaaatctac
atatcacccaagaatacagtcatttctgtgaatccatccacaaggcttcaagaaggtggc
tctgtgaccatgacatgttccagtgagggtctaccacctccagagattttctggagcaag
aaattagataatgggaatttacagcacctttctgggaatgcaactctcaccttaattgct
atgaggagggaagattctggaatttatgtgtgtgaaggagttaatctgattgggaaagac
agaaaagaggtggaattaattgttcaagagaaaccatttactgttgagatctcccctgga
ccccggattgctgctcggattggagactcggtcgtgttgacatgtggtgtcatgggctgt
gagtcaccatctttctcctggagaacccagatagatagtcctctgagtgggaaggtgagg
agtgaggggaccaattccacactgaccctgagccctgtgagttttgagaacgagcactct
tacctgtgcacagtgacttgtggacgtaagaaagtggaaaagggaatccaggtggagctc
tactcattccctagagatccagaaattgagatgagtggtctcctcgtgagtgggagccct
gtcactgtaagctgcaagattcctggtgtgtacccccttgaccggttggagattgagtta
tttaaaggggaaactattctgaagaataaggagtttttggaggatatggatatgaaatcc
ttagagacaaaaagtttggaaatgaccttcgtccctaccattgaagataatggaaaagtt
cttgtttgtcaagctaagttacatgtcgaagaaatggaattcgaacccaaacaaaggcaa
actacacagacactttatgtcaatgttgcccccagaaacacaactatctctgtcaggcct
tcctccatcctggaggaaggcagttctgtgaatatgacatgctccagccacgggctccct
gctccgaaaatcctgtggagcaggcagctacataacggggagctacagcctctttctgag
aatgcaactctcatcttaatttctacaaaaacggaagattctggggtttatgtgtgtgaa
ggaattaaccaggctgggagaagcagagaagacgtagaattaattatccaaggttctcca
aaagacatacaacttatagcttttccttctgagagtgtcagagaaggagacactgtcatc
atctcttgtacatgtggaaatgttccagaaacatggataatcttgaagaaaaaagcagag
acaggagacagagtactaaaatctatagacggtgcttataccatccgaaaggcccagttg
gaggatgcaggggtgtacgaatgtgaatctaaaaacaaggttggctcacaattaagaagt
ttaacacttgatgttcaaggaaaagaaaacaacaaagactatttttctcctgagcttctc
atgctctattgtgcatcctccttaataatacctgtcatcggaatgatcatttactttgca
agaagagccaacatgaaaggatcatatagtcttgtagaagcacagaaatcaaaagtgtag

DBGET integrated database retrieval system