KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385378Help
Entry
100385378         CDS       T03264                                 

Gene name
ARRB1
Definition
(RefSeq) arrestin beta 1
  KO
K04439  beta-arrestin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04062  Chemokine signaling pathway
cjc04144  Endocytosis
cjc04340  Hedgehog signaling pathway
cjc04740  Olfactory transduction
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100385378 (ARRB1)
   04340 Hedgehog signaling pathway
    100385378 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100385378 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100385378 (ARRB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100385378 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100385378 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    100385378 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100385378 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100385378 (ARRB1)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    100385378 (ARRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C BatD AP3B1_C LDB19 VPS28
Motif
Other DBs
NCBI-GeneID: 100385378
NCBI-ProteinID: XP_009005669
Ensembl: ENSCJAG00000015459
UniProt: U3D4S8
Position
11
AA seq 418 aa AA seqDB search
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKMVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaaagggacacgagtgttcaagaaggccagtccgaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacatcgacctcgtggaccctgtggatggtgtg
gtcctggtggatcctgagtatctgaaagagaggagagtctatgtgacgctgacctgtgcc
ttccgctatggccgagaggacctggatgtcctgggcctgacctttcgcaaggacctgttt
gtggccaatgtgcagtcctttccaccggcccccgaggacaagaagcccctgacacggctg
caggagcgcctcatcaagaagctgggcgagcacgcctaccctttcacctttgagatccct
ccaaaccttccatgctctgtgacattgcagccgggccccgaagacacggggaaggcttgc
ggtgtggactatgaagtcaaagccttctgtgcagagaatctggaggagaagatccacaag
cggaattctgtgcgtctggtcatccggaaagttcagtatgccccagagaggcctggtccc
cagcccacagccgagaccaccaggcagttcctaatgtcggacaagcccttacacctagag
gcctccctggataaggagatctattaccatggagaacccatcagcgtcaacgtccatgtc
accaacaacaccaacaagatggtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgccttttcaacacagctcagtacaagtgccctgttgccatggaagaggctgacgac
actgtggcacccagctcaacgttctgcaaggtctacacactgacccccttcctggccaac
aaccgtgagaagcggggccttgccctggatgggaagctcaagcatgaagacacgaacttg
gcctctagcaccctgttgagggaaggcgccaaccgtgagatcctggggatcattgtttcc
tacaaagtgaaagtgaagctggtggtgtctcggggcggcctgttgggagatcttgcatcc
agcgacgtggctgtggaactgcccttcaccctaatgcaccccaagcccaaagaggaacct
cctcatcgggaagttccagagaacgagacgccagtagataccaatctcatagaacttgac
acaaatgatgacgacattgtatttgaggactttgcccgtcagagactgaaaggcatgaag
gatgacaaggaggaagaggaggatggtactggctctccacagctcaacaacagatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387113Help
Entry
100387113         CDS       T03264                                 

Gene name
ARRB2
Definition
(RefSeq) arrestin beta 2
  KO
K04439  beta-arrestin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04062  Chemokine signaling pathway
cjc04144  Endocytosis
cjc04340  Hedgehog signaling pathway
cjc04740  Olfactory transduction
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100387113 (ARRB2)
   04340 Hedgehog signaling pathway
    100387113 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100387113 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100387113 (ARRB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100387113 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100387113 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    100387113 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100387113 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100387113 (ARRB2)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    100387113 (ARRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Motif
Other DBs
NCBI-GeneID: 100387113
NCBI-ProteinID: XP_002748318
Ensembl: ENSCJAG00000012115
UniProt: F7ISF7
Position
5
AA seq 409 aa AA seqDB search
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLSVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQT
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaaacccggcaccagggtcttcaagaagtcaagtcctaactgcaagctgacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacttgc
gccttccgctatggccgcgaagacttggatgtcctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccagtgcccaacccgccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcacaata
ccccagaatctgccatgctccgtcacactgcagccaggaccagaggatacggggaaggcc
tgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagccac
aaaaggaactctgtgcggctggtgatccgaaaggtgcagtttgccccggagaaacccggc
ccccagccttcagctgaaaccacacgccacttcctcatgtctgaccggtccctgcacctc
gaggcttccctggacaaggagctgtactaccatggggagcccctcagtgtaaatgtccac
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtacgcc
gacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcagctcgaacaagat
gaccaggtatctcccagctccacgttctgtaaggtgtacaccataaccccgctgctcagc
gacaaccgggagaagcggggtcttgccctggatgggaagctcaagcacgaggacaccaac
ctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctggtg
tcctacagggtcaaggtgaagctggtagtgtctcgaggcggggatgtctctgtggagctg
ccttttgttctcatgcatcccaagccccacgaccacatccccctccctagaccccagaca
gccgctccagaaacagacgtccctgtggacaccaacctcatcgaatttgataccaactat
gccacagatgatgacattgtatttgaggactttgcccggcttcggctgaaggggatgaag
gatgacgactatgatgaccagctctgctag

DBGET integrated database retrieval system