KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385413Help
Entry
100385413         CDS       T03264                                 

Gene name
PRKAA1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100385413 (PRKAA1)
   04068 FoxO signaling pathway
    100385413 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100385413 (PRKAA1)
   04152 AMPK signaling pathway
    100385413 (PRKAA1)
   04150 mTOR signaling pathway
    100385413 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100385413 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100385413 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100385413 (PRKAA1)
   04922 Glucagon signaling pathway
    100385413 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100385413 (PRKAA1)
   04921 Oxytocin signaling pathway
    100385413 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    100385413 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100385413 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100385413 (PRKAA1)
   04714 Thermogenesis
    100385413 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100385413 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    100385413 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100385413 (PRKAA1)
   04931 Insulin resistance
    100385413 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100385413 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100385413 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100385413 (PRKAA1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100385413 (PRKAA1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100385413 (PRKAA1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100385413 (PRKAA1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100385413 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100385413 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like Kdo FTA2 APH
Motif
Other DBs
NCBI-GeneID: 100385413
NCBI-ProteinID: XP_017821102
Position
2
AA seq 719 aa AA seqDB search
MTPVLISLLESPREGVFSDPQVVIRGDHSGQKLRQKRRAGGHCPPQRSRKPLRVPVGGHP
GQRMRGEEAGTGATPGGPRPPRQGERLRPTAAAGPGLLCGHGSPYIKLFDVSPLPLRRSP
APCWIYFILIILLSGWRAAKSALVLGGGGAGRNPRGGGQPRVWVVLPWLWASPSLLGGPR
RCPCSVVFGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVIS
TPSDIFMVMEYVSGGELFDYICKNGRKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDY
CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRL
YAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHML
QVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLS
CLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVA
ETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNP
YYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNY
RSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactccagtcctcatctcccttctggagtcacccagagagggggtcttctccgatccc
caagtggtaattaggggagatcacagcgggcagaaactccgccagaagagaagagccggg
ggccactgtccgcctcaacgttccaggaagcccctccgcgtgccagtgggcgggcaccca
ggccagaggatgcggggcgaggaggcgggtaccggtgccactcccggcggtcctcgcccg
ccccgccagggggagcgtctgcgcccgacggcggcagcgggtcctgggcttctttgtggt
cacggatccccttatattaaactgtttgacgtttcgcccctgcccttgcgaagatccccg
gcgccttgctggatttattttatcttgataatcttgctgtcgggctggcgggcggcgaag
agcgctctggtgttgggaggagggggcgccgggcgcaatcctcggggaggaggccaaccg
cgcgtctgggttgtgctcccgtggctctgggccagcccatcgctccttggcggtcctcgg
cgttgtccgtgttccgtcgtctttggcaaacatgaattaactgggcataaagtggctgtg
aagatactcaataggcagaagattcggagcctcgatgtggtgggaaaaatccgcagagaa
attcagaacctcaagcttttcaggcatcctcatataattaaactgtaccaggtcatcagt
acaccatctgatattttcatggtgatggaatatgtctctggaggagagctatttgattat
atctgtaagaatggaaggaaatctgatgtacctggagtagtaagaacaggctccatgaag
gagctggatgaaaaagaaagtcgacgtctgttccaacagatcctttctggtgtggattat
tgtcacaggcatatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagccgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgcaggcccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaacccttccatttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttctatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagggccacaattaaagatatcagggaacatgaatggtttaaa
caggaccttccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaagtttgaatgctcagaagaggaagttctcagc
tgtctttataacagaaatcaccaggaccctttggcagttgcttaccatctcataatagat
aacaggagaataatgaatgaagccaaagatttctatttggcgacaagcccacctgattct
tttcttgatgatcaccacctgactcgtccccatcctgaaagagtaccattcttggttgct
gaaacgccaagggcacgccatacccttgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttaggaattagaagtcaaagtcgaccaaatgatatt
atggcagaagtctgtagagcaattaaacaattggattatgaatggaaggttgtaaacccc
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacttactccaaaatgagtcta
cagttataccaagtggacagtagaacttacctactggatttccgtagtattgatgatgaa
attacagaagccaaatcagggactgctactccacagagatcgggatcagttagcaactat
cgatcttgccaaaggagtgattcagatgctgaggctcaaggaaaatcctcagaagtttct
cttacctcatctgtgacctcacttgactcttctcctgttgacctaactccgagacctgga
agtcatacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386781Help
Entry
100386781         CDS       T03264                                 

Gene name
PRKAG2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100386781 (PRKAG2)
   04068 FoxO signaling pathway
    100386781 (PRKAG2)
   04152 AMPK signaling pathway
    100386781 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100386781 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100386781 (PRKAG2)
   04922 Glucagon signaling pathway
    100386781 (PRKAG2)
   04920 Adipocytokine signaling pathway
    100386781 (PRKAG2)
   04921 Oxytocin signaling pathway
    100386781 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    100386781 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    100386781 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100386781 (PRKAG2)
   04714 Thermogenesis
    100386781 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100386781 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100386781 (PRKAG2)
   04931 Insulin resistance
    100386781 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 100386781
NCBI-ProteinID: XP_002751897
Ensembl: ENSCJAG00000020422
Position
8
AA seq 444 aa AA seqDB search
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEP
ERLENRIYASSSPPDMGQRFCPSSFQSPTRPPLASLTHYAPCKAAALAAAPGPAEAGMLE
KLEFEDEVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAP
LWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNIS
PDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMCDMPKPAFMKQNL
DELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEK
TYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGII
SLSDILQALVLTPAGAKQKETETE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctttgggagtcttaggagcaacaagaaacacaaggaccaaaaccgaagcacg
gagaggcgccagtcagagccccatggccttttcgcctccggcctctcctcctctccgtcc
acacccacgcaagtgaccaagcagcacacatttcccctcgagtcctataagcatgagcct
gaacggttggagaatcgcatctatgcctcctcttcccctccagacatggggcagaggttc
tgcccgtcctccttccagagcccgaccaggcctccactggcatcactgacacactatgct
ccctgcaaagccgcggcgctggcggcggccccgggacccgcggaagccggcatgctggaa
aagctggagttcgaggacgaagtagaagactcagagagtggtgtttacatgcgattcatg
aggtcacacaagtgttatgacattgttccaaccagttcaaagcttgtcgtcttcgatact
acattacaagttaaaaaggccttctttgccttggtagccaatggcgtccgagcagcgcca
ctgtgggagagtaaaaagcaaagctttgtaggaatgctaacaattacagatttcataaat
atactgcacagatactataaatcacctatggtacagatttatgaattagaggaacataaa
attgaaacatggagggagctttatttacaagaaacatttaagcctttagtgaatatatct
ccagatgcaagcctcttcgatgctgtatactccttgatcaaaaataaaatccacagattg
ccagtgattgaccctatcagtgggaatgcactttatattcttacccacaaaagaatcctc
aagttcctccagctttttatgtgtgatatgccaaagcctgccttcatgaagcagaacctg
gatgagctggggataggaacgtaccacaacatcgccttcatacacccagacacccccatc
atcaaagccttgaacatatttgtggagagacgaatatcagctctgcccgttgtggatgag
tcaggaaaagttgtagatatttattccaaatttgatgtaattaatcttgctgctgagaaa
acatacaataacctagatatcacagtgacccaggcccttcagcaccgttcacagtatttt
gaaggtgttgtaaagtgcaataagctggagatactggagaccattgtggacagaatagtg
agagcggaggtccatcggctggtggtggtgaatgaagcagatagtatcgtgggtattatt
tccctgtcggacattctgcaggccctggtcctgacaccggcaggtgccaaacagaaggag
acggaaacagaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390042Help
Entry
100390042         CDS       T03264                                 

Gene name
PRKAG1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100390042 (PRKAG1)
   04068 FoxO signaling pathway
    100390042 (PRKAG1)
   04152 AMPK signaling pathway
    100390042 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100390042 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100390042 (PRKAG1)
   04922 Glucagon signaling pathway
    100390042 (PRKAG1)
   04920 Adipocytokine signaling pathway
    100390042 (PRKAG1)
   04921 Oxytocin signaling pathway
    100390042 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    100390042 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    100390042 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100390042 (PRKAG1)
   04714 Thermogenesis
    100390042 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100390042 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100390042 (PRKAG1)
   04931 Insulin resistance
    100390042 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3 DUF2497
Motif
Other DBs
NCBI-GeneID: 100390042
NCBI-ProteinID: XP_002752469
Ensembl: ENSCJAG00000020827
Position
9
AA seq 359 aa AA seqDB search
MWPCRTGCGAGPAPRELPKARTKPAPLAMETVISSDSSPAVENEHPQETPESNNSVYTSF
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHR
LPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTP
VYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHY
FEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKNP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtggccttgccgcaccggatgtggggcggggcctgccccaagagagcttcctaaagcg
agaaccaagccggcgcctcttgcaatggagacggtcatttcttcagatagctccccagct
gtggaaaatgagcatcctcaagagaccccagaatccaacaatagcgtgtatacttccttc
atgaagtctcatcgctgctatgacctgattcccacaagctccaaattggttgtatttgat
acatccctgcaggtgaagaaagctttctttgctttggtgactaacggtgtacgagctgcc
cctttatgggatagtaagaagcaaagttttgtgggtatgctgaccatcactgatttcatc
aatattctgcaccgctactataaatcagccttggtacagatctatgagctagaagaacac
aagatagaaacttggagagaggtgtacctccaggactcctttaaaccgcttgtctgcatt
tctcctaatgccagcttgtttgatgctgtctcttcattaattcggaacaagatccacagg
ctgccagttattgacccagaatcgggcaatactttgtacatcctcacccacaagcgcatt
ctgaagttcctcaaattgtttatcactgaatttcccaagccagagttcatgtccaagtct
ctggaagagctacagattggcacctatgccaatattgctatggttcgcactactaccccc
gtctatgtggctctgggcatttttgtacagcatcgagtctcagctctgccagtggtggat
gagaaggggcgtgtggtggacatctactccaagtttgatgtgatcaatctggcagcagaa
aagacctacaacaacctagatgtgtctgtgactaaagccctgcaacaccgatcacactac
tttgagggtgttctcaagtgctacctgcatgagactctggagaccatcatcaacaggcta
gtggaagcagaggttcaccgacttgtagtggtggatgaaaatgatgtggtcaagggaatt
gtatcactgtctgacatcctgcaggccctggtgcttacaggtggagagaagaatccctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394141Help
Entry
100394141         CDS       T03264                                 

Gene name
PRKAG3
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100394141 (PRKAG3)
   04068 FoxO signaling pathway
    100394141 (PRKAG3)
   04152 AMPK signaling pathway
    100394141 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100394141 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100394141 (PRKAG3)
   04922 Glucagon signaling pathway
    100394141 (PRKAG3)
   04920 Adipocytokine signaling pathway
    100394141 (PRKAG3)
   04921 Oxytocin signaling pathway
    100394141 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    100394141 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    100394141 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100394141 (PRKAG3)
   04714 Thermogenesis
    100394141 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100394141 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100394141 (PRKAG3)
   04931 Insulin resistance
    100394141 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 100394141
NCBI-ProteinID: XP_002749843
Ensembl: ENSCJAG00000011362
Position
6
AA seq 489 aa AA seqDB search
MEPELEHALRRTPSWSSLGDSEHQEMNFLEQEDSTSWPSPAVTSSSERIRGKRRAKASRW
TRQEAVEEGEPPGLGEGPRSRPAAESTGLEATFPKAIPLAQADPAGVGTPPTGWDSLPHD
CTASAAGSSPDDAELASEFPATEAWERKPEDLVEERPAPSRSPEALFPKLGWDDELQKPG
AQVYMRFMQEHTCYDAMATSSKLVIIDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSISPNDSLFEAVYAL
IKNRIHRLPVLDPVSGTVLHILTHKRLLKFLHIFGTLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNEYGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgagctggagcacgctctgcgcaggaccccttcctggagcagccttggggat
tctgagcatcaagagatgaacttcctagagcaagaagacagcacctcatggccatcacca
gccgtgaccagtagctcagaaagaatccgtgggaaacggagggccaaggcctcaagatgg
acaaggcaggaggcggtggaggaaggggagccaccgggtctgggggaaggtccccggtcc
aggccagctgctgagtccactgggctggaggccacattccccaaggccatacccttggct
caggctgatcctgctggggtgggcactccaccaacagggtgggacagcctcccccatgac
tgcacagcctcagctgcaggctctagcccagatgatgcggagctggcctcggagttccca
gccacagaggcctgggagcgtaagccagaagacctggtggaagagaggcctgccccaagc
cggtccccggaggccctgtttcccaagctgggctgggatgacgagctgcagaaacccggt
gcccaggtctacatgcgcttcatgcaggagcacacctgctacgacgccatggcaaccagc
tccaagctggtcatcatcgacaccatgctggagatcaagaaggctttctttgccctggtg
gccaacggtgtgcgggcagcccctctgtgggacagcaagaagcagagctttgtggggatg
ctgaccatcactgacttcatcctggtgctgcatcgctactacaggtccccactggtccag
atctatgagattgaagaacataagattgagacctggagggagatctacctgcaaggctgc
ttcaagcctctggtttccatctcgcctaatgacagcctgtttgaagctgtctatgccctc
atcaagaatcggatccatcgcctgcctgttctggacccagtatcgggcactgtactccac
atcctcacacacaaacgcctgctcaagttcctgcacatctttggtaccctgctgccccgg
ccctccttcctctaccgcactatccaagatttgggcatcggcacatttcgagacttggct
gtggtgctggagacagcacccatcctgactgcactggacatctttgtggaccggcgtgtg
tctgcactgcctgtggtcaacgaatatggtcaggtcgtgggcctctattcccgctttgac
gtgattcacctggctgcccagcaaacctacaaccatctggacatgagtgtgggagaagct
ctgaggcagaggacactatgtctggagggagtcctttcctgccagccccacgagagcttg
ggggaagtgatcgacaggattgctcgggagcaggtacacaggctggtgctagtggacgag
acccagcatctcttgggcgtggtctccctctccgacatccttcaggcactggtgctcagc
cctgctggcattgatgctctcgggtcctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396565Help
Entry
100396565         CDS       T03264                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100396565 (PRKAA2)
   04068 FoxO signaling pathway
    100396565 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100396565 (PRKAA2)
   04152 AMPK signaling pathway
    100396565 (PRKAA2)
   04150 mTOR signaling pathway
    100396565 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100396565 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100396565 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100396565 (PRKAA2)
   04922 Glucagon signaling pathway
    100396565 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100396565 (PRKAA2)
   04921 Oxytocin signaling pathway
    100396565 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    100396565 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100396565 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100396565 (PRKAA2)
   04714 Thermogenesis
    100396565 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100396565 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    100396565 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100396565 (PRKAA2)
   04931 Insulin resistance
    100396565 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100396565 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100396565 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100396565 (PRKAA2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100396565 (PRKAA2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100396565 (PRKAA2)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100396565 (PRKAA2)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100396565 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100396565 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100396565
NCBI-ProteinID: XP_002750917
Ensembl: ENSCJAG00000015889
Position
7
AA seq 552 aa AA seqDB search
MAEKQKHDGWVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTAAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggtgggtgaagatcggacactacgtgctgggcgac
acgctaggcgtcggcaccttcggcaaagtgaagattggagaacatcaattaacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctgaaactctttcgtcatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggaggtgaa
ttatttgactacatctgtaagcatggacgggttgaagagatggaagccaggcggctcttt
cagcagattctgtctgctgtggattactgtcataggcatatggttgttcaccgagacctg
aaaccagaaaatgtcctgttggatgcacatatgaatgccaagatagctgattttggatta
tctaatatgatgtcagatggtgaatttctaagaactagttgtggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgtgatcttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtacct
acgttatttaagaagatccgaggtggtgtcttttatatcccagaatatctcaatcgttct
gtcgccactctcctgatgcatatgcttcaggtcgacccactgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccttcctatgatgctaatgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaatcaagccagtgagttc
tacctcgcttctagtcctccatctggttcttttatggatgatagtgccatgcatattcct
ccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagccccaaagca
agatgtccattggatgcactgaatacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatccgaagtcagagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcaactggattttgaatggaaggtagttaatgcataccatctacgtgta
agaagaaaaaatccagtgactggcaattatgtgaaaatgagcttacaactttacctggtt
gataacaggagctatcttttggactttaaaagcattgatgatgaagtagtggagcagagg
tctggttcctcaacacctcagcgttcctgttctgctgctggcttacacagaccaagatca
agttttgattccacagctgcagagagccactccctttctggctctctcactggctctttg
actggaagcacattgtcttcagtttcacctcgtctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgatcactactttagcccgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406673Help
Entry
100406673         CDS       T03264                                 

Gene name
PRKAB2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100406673 (PRKAB2)
   04068 FoxO signaling pathway
    100406673 (PRKAB2)
   04152 AMPK signaling pathway
    100406673 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100406673 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100406673 (PRKAB2)
   04922 Glucagon signaling pathway
    100406673 (PRKAB2)
   04920 Adipocytokine signaling pathway
    100406673 (PRKAB2)
   04921 Oxytocin signaling pathway
    100406673 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    100406673 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    100406673 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100406673 (PRKAB2)
   04714 Thermogenesis
    100406673 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100406673 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100406673 (PRKAB2)
   04931 Insulin resistance
    100406673 (PRKAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 100406673
NCBI-ProteinID: XP_002759874
Ensembl: ENSCJAG00000002530
UniProt: F6YM87
Position
18
AA seq 272 aa AA seqDB search
MGNTASDRVSGDRHGAKAARAEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSEASCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaccgccagcgaccgggtgtccggggaccgtcacggcgccaaggctgcacgc
gccgagggcgccggcggccatgccccggggaaggagcacaagatcatggtgggaagcacg
gacgaccccagcgtgttcagcctgcccgactccaagctccctggggacaaagagtttgta
tcctggcagcaggatttggaggactccgtaaagcccacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcctggacctccctgag
ggagaacaccaatacaagttctttgtggatggacagtgggttcatgatccatcagagcct
gtggttaccagtcagctcggcacaattaacaatttgatccatgtcaagaaatcggatttt
gaggtgttcgatgctttaaagctagactctatggaaagttctgaggcatcttgtagagac
ctttccagctcacctccagggccttatggtcaagaaatgtatgtgtttcgatctgaggaa
agattcaaatctcctcccatccttcctcctcatctacttcaagttattcttaacaaagac
actaatatttcttgtgacccagccttactccctgagcccaaccatgttatgctgaaccat
ctctatgcattgtccattaaggacagtgtgatggtcctcagcgcaacccatcgctacaag
aagaagtatgttactactctgctgtacaagcccatctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409760Help
Entry
100409760         CDS       T03264                                 

Gene name
PRKAB1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04710  Circadian rhythm
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100409760 (PRKAB1)
   04068 FoxO signaling pathway
    100409760 (PRKAB1)
   04152 AMPK signaling pathway
    100409760 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100409760 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100409760 (PRKAB1)
   04922 Glucagon signaling pathway
    100409760 (PRKAB1)
   04920 Adipocytokine signaling pathway
    100409760 (PRKAB1)
   04921 Oxytocin signaling pathway
    100409760 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    100409760 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    100409760 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100409760 (PRKAB1)
   04714 Thermogenesis
    100409760 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100409760 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100409760 (PRKAB1)
   04931 Insulin resistance
    100409760 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 100409760
NCBI-ProteinID: XP_017831902
Ensembl: ENSCJAG00000009119
UniProt: F7BMG6
Position
9
AA seq 270 aa AA seqDB search
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgagcagtgagcgcgccgcgttggagcggcatggtggccataagacgccc
cggagggacagctcggggggcaccaaggatggggacaggcccaagatcctgatggacagc
cccgaggatgccgacctcttccactccgaggaaatcaaggcaccagagaaggaggaattc
ctggcctggcagcacgatctggaagtgaatgataaagctcccgcccaggctcggccaact
gtgtttcgatggacggggggtgggaaggaagtttacttatctgggtccttcaacaactgg
agtaaacttcccctcacgagaagccacaataactttgtagccatcctggatctgccagaa
ggagagcatcagtacaagttctttgtggatggtcagtggacccacgacccttccgagccc
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agttctcccccaggaccctaccatcaggagccctacgtctgcaaacctgaagagcgcttt
cgggcgccgcccattctccccccacatctcctccaggtcatcctgaacaaggacacgggg
atttcctgtgatccagctttgctccctgagcccaatcacgtcatgctgaaccacctgtat
gcactgtccatcaaggacggagtaatggtgctcagcgcaacccaccggtacaagaagaag
tacgtcaccaccttgttatacaagcccatatga

DBGET integrated database retrieval system