KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385427Help
Entry
100385427         CDS       T03264                                 

Gene name
CAJA-DRA
Definition
(RefSeq) major histocompatibility complex, class II, DR alpha
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100385427 (CAJA-DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100385427 (CAJA-DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100385427 (CAJA-DRA)
   04612 Antigen processing and presentation
    100385427 (CAJA-DRA)
   04658 Th1 and Th2 cell differentiation
    100385427 (CAJA-DRA)
   04659 Th17 cell differentiation
    100385427 (CAJA-DRA)
   04672 Intestinal immune network for IgA production
    100385427 (CAJA-DRA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100385427 (CAJA-DRA)
   05322 Systemic lupus erythematosus
    100385427 (CAJA-DRA)
   05323 Rheumatoid arthritis
    100385427 (CAJA-DRA)
   05320 Autoimmune thyroid disease
    100385427 (CAJA-DRA)
   05321 Inflammatory bowel disease (IBD)
    100385427 (CAJA-DRA)
   05330 Allograft rejection
    100385427 (CAJA-DRA)
   05332 Graft-versus-host disease
    100385427 (CAJA-DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100385427 (CAJA-DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100385427 (CAJA-DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100385427 (CAJA-DRA)
   05152 Tuberculosis
    100385427 (CAJA-DRA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100385427 (CAJA-DRA)
   05164 Influenza A
    100385427 (CAJA-DRA)
   05168 Herpes simplex virus 1 infection
    100385427 (CAJA-DRA)
   05169 Epstein-Barr virus infection
    100385427 (CAJA-DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100385427 (CAJA-DRA)
   05140 Leishmaniasis
    100385427 (CAJA-DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100385427 (CAJA-DRA)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100385427 (CAJA-DRA)
  Exosomal proteins of epithelial cells
   100385427 (CAJA-DRA)
  Exosomal proteins of breast milk
   100385427 (CAJA-DRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Motif
Other DBs
NCBI-GeneID: 100385427
NCBI-ProteinID: NP_001257840
Ensembl: ENSCJAG00000001688
UniProt: U3E867
Position
4
AA seq 254 aa AA seqDB search
MAVSGVLVLGFFLMIVLMSPQESWAIKEEHVIIQAEFYLNPEQSGEFMFDFDGDEIFHVD
MTKKETVWRLEEFGKFASFEAQGALANIAVDKANLEIMTKRSNNTPISNVPPEVTVLTDS
PVELGEPNVLICFIDKFTPPVVNVTWLQNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDIYDCKVEHLGLDEPLLKHWEYDAPSPLPETTENVVCALGLIVGLVGIIVGTIFIIK
GVRKSNATERRGPL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaagtggagtcttggtgctaggatttttcctcatgattgtgctgatgagccct
caggaatcatgggccatcaaagaagaacacgtgatcatccaggccgagttctatctgaac
cctgagcaatcaggggagtttatgtttgactttgatggtgatgagattttccacgtggat
atgacaaagaaggagacggtctggcgacttgaagaatttgggaaattcgccagctttgag
gcccagggtgcactggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgttccaacaatactccgatctccaacgttcctccagaggtaactgtgctcacagacagc
cctgtggaactgggagagcccaacgtcctcatctgtttcatcgacaaattcaccccacca
gtggtcaatgtcacatggcttcaaaatggaaaacctgtcactacaggagtgtcagagaca
gtcttcctacccagggaagaccatcttttccgcaagttccactatctccccttcctgccc
tcaactgaggacatttatgactgcaaggtggagcacttgggcttggatgagcctcttctc
aagcactgggagtatgatgcaccaagccctctcccagagactacagagaatgtggtgtgt
gccctgggcctgattgtgggtctggtaggcatcatcgttgggaccatcttcatcatcaag
ggtgtgcgcaaaagcaatgctacagaacgcagggggcctctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386155Help
Entry
100386155         CDS       T03264                                 

Gene name
CAJA-DRB1, Caja-DRB
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-13 beta chain-like
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100386155 (CAJA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100386155 (CAJA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100386155 (CAJA-DRB1)
   04612 Antigen processing and presentation
    100386155 (CAJA-DRB1)
   04658 Th1 and Th2 cell differentiation
    100386155 (CAJA-DRB1)
   04659 Th17 cell differentiation
    100386155 (CAJA-DRB1)
   04672 Intestinal immune network for IgA production
    100386155 (CAJA-DRB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100386155 (CAJA-DRB1)
   05322 Systemic lupus erythematosus
    100386155 (CAJA-DRB1)
   05323 Rheumatoid arthritis
    100386155 (CAJA-DRB1)
   05320 Autoimmune thyroid disease
    100386155 (CAJA-DRB1)
   05321 Inflammatory bowel disease (IBD)
    100386155 (CAJA-DRB1)
   05330 Allograft rejection
    100386155 (CAJA-DRB1)
   05332 Graft-versus-host disease
    100386155 (CAJA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100386155 (CAJA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100386155 (CAJA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100386155 (CAJA-DRB1)
   05152 Tuberculosis
    100386155 (CAJA-DRB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386155 (CAJA-DRB1)
   05164 Influenza A
    100386155 (CAJA-DRB1)
   05168 Herpes simplex virus 1 infection
    100386155 (CAJA-DRB1)
   05169 Epstein-Barr virus infection
    100386155 (CAJA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100386155 (CAJA-DRB1)
   05140 Leishmaniasis
    100386155 (CAJA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100386155 (CAJA-DRB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100386155 (CAJA-DRB1)
  Exosomal proteins of epithelial cells
   100386155 (CAJA-DRB1)
  Exosomal proteins of breast milk
   100386155 (CAJA-DRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set ig Ig_3 Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 100386155
NCBI-ProteinID: NP_001254681
Ensembl: ENSCJAG00000001638
UniProt: Q257X7
Position
4
AA seq 241 aa AA seqDB search
MLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRFLDRYFFNQEENLRFDSDVGEFR
AVTELGRPDAESWNSQKDLLEQRRAAVDTFCRHNYEILDRFLVPRRVQPKVTVYPAKAQP
LQHHNLLVCSVSGFYPGSIEVRWFRNDQEEKTGVVSTGLIQNGDWTFQTLVMLETLPQSG
EVYTCQVEHPSVTSPLTVQWRAQSESAQSKMLSGVGGSVLGLLFLGAGLFIYFRNQKGLL
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgctgatggtgctgagctccccactggctttggctggggacacccgaccacgtttcttg
gagtatagcacgtctgagtgtcatttcttcaacgggacggagcgggtgcggttcctggac
agatacttctttaatcaggaggagaacttgcgcttcgacagcgacgtgggggagttccgg
gcggtgacggagctggggcggcctgacgcggagtcctggaacagccagaaggacctcctg
gagcagaggcgggccgcggtggacaccttctgcagacacaactacgagattttagacagg
ttcctagtgccgcggagagtccaacctaaggtgactgtgtatcctgcaaaggcccagccc
ctgcagcaccacaacctcctggtctgctctgtgagtgggttctatccaggcagcattgaa
gtcaggtggttccggaacgaccaggaggagaagactggggtggtgtccacaggcctgatc
cagaatggagactggaccttccagaccctggtgatgctggaaacacttcctcagagtgga
gaggtttacacctgccaagtggagcacccaagcgtgaccagccctctcacagtgcaatgg
agagcacagtctgaatctgcacagagcaagatgctgagtggagtcgggggctctgtgctg
ggcctgctcttccttggggcagggctgttcatctacttcaggaatcagaaaggactcctg
agctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386508Help
Entry
100386508         CDS       T03264                                 

Gene name
HLA-DQA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100386508 (HLA-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100386508 (HLA-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100386508 (HLA-DQA1)
   04612 Antigen processing and presentation
    100386508 (HLA-DQA1)
   04658 Th1 and Th2 cell differentiation
    100386508 (HLA-DQA1)
   04659 Th17 cell differentiation
    100386508 (HLA-DQA1)
   04672 Intestinal immune network for IgA production
    100386508 (HLA-DQA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100386508 (HLA-DQA1)
   05322 Systemic lupus erythematosus
    100386508 (HLA-DQA1)
   05323 Rheumatoid arthritis
    100386508 (HLA-DQA1)
   05320 Autoimmune thyroid disease
    100386508 (HLA-DQA1)
   05321 Inflammatory bowel disease (IBD)
    100386508 (HLA-DQA1)
   05330 Allograft rejection
    100386508 (HLA-DQA1)
   05332 Graft-versus-host disease
    100386508 (HLA-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100386508 (HLA-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100386508 (HLA-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100386508 (HLA-DQA1)
   05152 Tuberculosis
    100386508 (HLA-DQA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386508 (HLA-DQA1)
   05164 Influenza A
    100386508 (HLA-DQA1)
   05168 Herpes simplex virus 1 infection
    100386508 (HLA-DQA1)
   05169 Epstein-Barr virus infection
    100386508 (HLA-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100386508 (HLA-DQA1)
   05140 Leishmaniasis
    100386508 (HLA-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100386508 (HLA-DQA1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100386508 (HLA-DQA1)
  Exosomal proteins of epithelial cells
   100386508 (HLA-DQA1)
  Exosomal proteins of breast milk
   100386508 (HLA-DQA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A C2-set_2 Ig_3
Motif
Other DBs
NCBI-GeneID: 100386508
NCBI-ProteinID: XP_008992457
Ensembl: ENSCJAG00000021549
Position
4
AA seq 255 aa AA seqDB search
MILNKALMLGALVLTTVMSPCGGENIAADHVAACGINLYQSYGPTGQYTHEFDGDEQFYV
DLGRKETLWRWPMLSKFGGFDPQGALTNIATMKHNLDIVIKRSNCTAATNEVPEATVFSK
SPVALGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKMSYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPXPTSELTETVVCALGLSVGLXGIVVGTVFII
QGLRSVDASRHQGPL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaataaagctctgatgctgggggccctcgtcctgaccaccgtgatgagcccc
tgtggaggtgaaaacattgcggctgaccatgttgccgcttgcggtataaacttgtaccag
tcttatggtcccactgggcagtacacccatgaatttgatggagatgaacagttctacgtg
gacctggggagaaaggagactctctggcggtggcctatgttgagcaaatttggaggtttt
gacccgcagggcgcactgacaaacatcgctacgatgaaacacaacttggacatcgtgatt
aaacgctccaactgtaccgctgctaccaatgaggttcctgaggccacagtgttttccaag
tctcccgtggcgctgggtcagcccaacaccctcatctgccttgtggacaacatcttccct
cccgtggtcaacatcacatggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatgagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggacgagcctctt
ctgaaacactgggagcccgagattccangccctacgtcagagctcacagagactgtggtc
tgcgccctggggttgtctgtgggcttgntgggcattgtggtgggcactgttttcatcatc
caaggtcttcgttcagttgatgcttccagacaccaagggcccttgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386865Help
Entry
100386865         CDS       T03264                                 

Gene name
Caja-DQB1, HLA-DQB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100386865 (Caja-DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100386865 (Caja-DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100386865 (Caja-DQB1)
   04612 Antigen processing and presentation
    100386865 (Caja-DQB1)
   04658 Th1 and Th2 cell differentiation
    100386865 (Caja-DQB1)
   04659 Th17 cell differentiation
    100386865 (Caja-DQB1)
   04672 Intestinal immune network for IgA production
    100386865 (Caja-DQB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100386865 (Caja-DQB1)
   05322 Systemic lupus erythematosus
    100386865 (Caja-DQB1)
   05323 Rheumatoid arthritis
    100386865 (Caja-DQB1)
   05320 Autoimmune thyroid disease
    100386865 (Caja-DQB1)
   05321 Inflammatory bowel disease (IBD)
    100386865 (Caja-DQB1)
   05330 Allograft rejection
    100386865 (Caja-DQB1)
   05332 Graft-versus-host disease
    100386865 (Caja-DQB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100386865 (Caja-DQB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100386865 (Caja-DQB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100386865 (Caja-DQB1)
   05152 Tuberculosis
    100386865 (Caja-DQB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386865 (Caja-DQB1)
   05164 Influenza A
    100386865 (Caja-DQB1)
   05168 Herpes simplex virus 1 infection
    100386865 (Caja-DQB1)
   05169 Epstein-Barr virus infection
    100386865 (Caja-DQB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100386865 (Caja-DQB1)
   05140 Leishmaniasis
    100386865 (Caja-DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100386865 (Caja-DQB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100386865 (Caja-DQB1)
  Exosomal proteins of epithelial cells
   100386865 (Caja-DQB1)
  Exosomal proteins of breast milk
   100386865 (Caja-DQB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 MHC_I
Motif
Other DBs
NCBI-GeneID: 100386865
NCBI-ProteinID: XP_008992459
Ensembl: ENSCJAG00000001638
Position
4
AA seq 261 aa AA seqDB search
MSWKKALWIPGGLRAAAVTLMLVMLSSPVAEGRDSPEDFVYQFKFLCYFTNGTERVRLVT
EYVYNREEHVRFDSDVGEYWAVTPLGLPDAKYWNSQKDILERTRAELDTVCTHNYEVAFR
GILQWRVEPTVIISPSKTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEQSAGIVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIRQRSRKGLLH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaagaaggctttgtggatccccggaggacttcgggcagcagctgtgaccttg
atgctggtgatgctgagcagcccagtggctgagggcagagactctccagaggatttcgtg
taccagtttaagtttctctgctacttcaccaacgggacagagcgcgtgcgtcttgtgaca
gaatacgtctataacagagaggagcacgtgcgcttcgacagcgacgtgggggagtattgg
gcggtgacgccgctggggctgcctgacgccaagtactggaacagccagaaggacatcctg
gagaggacccgggcggagctggacacggtgtgcacgcacaactacgaggtggcgttccgc
gggatcttgcagtggcgagtggagcctacagtgatcatctctccatccaagacagaggcc
ctcaatcaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgaccaggagcagtcagccggcattgtgtccactccccttatc
aggaatggtgactggaccttccagattctagtgatgctggaaatgactccccagcgtgga
gacgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcagtctgaatctgcccagagcaaaatgctgagtggcattggaggcttcgtgctg
gggctgatcttcctcgggctgggacttatcatccgtcaaaggagtcgtaaaggactcctg
cactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387227Help
Entry
100387227         CDS       T03264                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100387227
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100387227
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100387227
   04612 Antigen processing and presentation
    100387227
   04658 Th1 and Th2 cell differentiation
    100387227
   04659 Th17 cell differentiation
    100387227
   04672 Intestinal immune network for IgA production
    100387227
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100387227
   05322 Systemic lupus erythematosus
    100387227
   05323 Rheumatoid arthritis
    100387227
   05320 Autoimmune thyroid disease
    100387227
   05321 Inflammatory bowel disease (IBD)
    100387227
   05330 Allograft rejection
    100387227
   05332 Graft-versus-host disease
    100387227
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100387227
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100387227
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100387227
   05152 Tuberculosis
    100387227
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100387227
   05164 Influenza A
    100387227
   05168 Herpes simplex virus 1 infection
    100387227
   05169 Epstein-Barr virus infection
    100387227
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100387227
   05140 Leishmaniasis
    100387227
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100387227
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100387227
  Exosomal proteins of epithelial cells
   100387227
  Exosomal proteins of breast milk
   100387227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set C2-set_2 Ig_3 Marek_A WW
Motif
Other DBs
NCBI-GeneID: 100387227
NCBI-ProteinID: XP_002746429
Ensembl: ENSCJAG00000021549
Position
4
AA seq 259 aa AA seqDB search
MILNKALMLGALVLTTVLTTVMSPCGGEDIVADHVASYGVNFYQSYGPSGQYTHEFDGDE
EFYVDLETKETVWRLPVFSTFISFDPQSALRNMAVGRHTLEFMIKQSNSTAATNEVPEVT
VFSKSPVVLGQPNTLICLVDNIFPPVVNITWLSNGHSVTDGVSETSFLSKSDHSFFKISY
LTFLPSADEIFDCEVEHWGLDEPLLKHWEPEIPAPLSELTETVVCTLGLSVGLMGIVVGT
VFIIKGLCSVDASRHQGPL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgatgctgggggcccttgtcctgaccaccgtcctgaccacc
gtgatgagcccctgtggaggtgaagacattgtggctgaccatgttgcctcctatggcgtg
aacttctaccagtcttacggtccttctggccagtacacccatgaatttgatggagatgag
gagttctacgtggacctggagacaaaggagactgtctggcggttgcccgtgtttagcaca
tttataagttttgacccgcagagtgcactgagaaacatggctgtgggaagacacaccttg
gaattcatgattaaacagtccaattccactgccgctaccaatgaggttcctgaggtcaca
gtgttttccaagtctcccgtggtgctgggtcagcccaacaccctcatctgccttgtggac
aacatcttccctcccgtggtcaacatcacatggctgagcaatgggcactcagtcacagat
ggtgtttctgagaccagcttcctctccaagagtgatcattccttcttcaagatcagttac
ctcaccttcctcccttctgctgatgagatttttgactgcgaggtggagcactggggcctg
gacgagcctcttctgaaacactgggagcctgagattccagcccctctgtcagagctcaca
gagactgtggtctgcaccctggggttgtctgtgggcctcatgggcattgtggtgggcact
gtcttcatcatcaaaggcctgtgttctgttgatgcttccagacaccaagggcccttgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387854Help
Entry
100387854         CDS       T03264                                 

Gene name
HLA-DRB1, caja-DRB, caja-DRB1
Definition
(RefSeq) h-2 class II histocompatibility antigen, I-A beta chain-like
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100387854 (HLA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100387854 (HLA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100387854 (HLA-DRB1)
   04612 Antigen processing and presentation
    100387854 (HLA-DRB1)
   04658 Th1 and Th2 cell differentiation
    100387854 (HLA-DRB1)
   04659 Th17 cell differentiation
    100387854 (HLA-DRB1)
   04672 Intestinal immune network for IgA production
    100387854 (HLA-DRB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100387854 (HLA-DRB1)
   05322 Systemic lupus erythematosus
    100387854 (HLA-DRB1)
   05323 Rheumatoid arthritis
    100387854 (HLA-DRB1)
   05320 Autoimmune thyroid disease
    100387854 (HLA-DRB1)
   05321 Inflammatory bowel disease (IBD)
    100387854 (HLA-DRB1)
   05330 Allograft rejection
    100387854 (HLA-DRB1)
   05332 Graft-versus-host disease
    100387854 (HLA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100387854 (HLA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100387854 (HLA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100387854 (HLA-DRB1)
   05152 Tuberculosis
    100387854 (HLA-DRB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100387854 (HLA-DRB1)
   05164 Influenza A
    100387854 (HLA-DRB1)
   05168 Herpes simplex virus 1 infection
    100387854 (HLA-DRB1)
   05169 Epstein-Barr virus infection
    100387854 (HLA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100387854 (HLA-DRB1)
   05140 Leishmaniasis
    100387854 (HLA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100387854 (HLA-DRB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100387854 (HLA-DRB1)
  Exosomal proteins of epithelial cells
   100387854 (HLA-DRB1)
  Exosomal proteins of breast milk
   100387854 (HLA-DRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set ig Ig_3 DUF202
Motif
Other DBs
NCBI-GeneID: 100387854
NCBI-ProteinID: NP_001254660
UniProt: Q257X3
Position
Un
AA seq 266 aa AA seqDB search
MVCLRFPGGSCVAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRFLDRYF
FNQEENLRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQRRAEVDTFCRHNYEILDRFLV
PRRVQPKVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNDQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPQSGEVYICQVEHPSVTSPLTVQWRAWSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGRSGLQPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgagattccctggaggctcctgcgtggcagcgctgacagtgacgctgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttggagtatagc
acgtctgagtgtcatttcttcaacgggacggagcgggtgcggttcctggacagatacttc
tttaatcaggaggagaacttgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgacgcggagtactggaacagccagaaggacctcctggagcagagg
cgggccgaggtggacaccttctgcagacacaactacgagattttagacaggttcctagtg
ccgcggagagtacaacctaaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgagtggtttctacccaggcagcattgaagtcaggtgg
ttccggaatgatcaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtttat
atctgccaagtggagcacccaagcgtgaccagccctctcacagtgcaatggagagcatgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggcagggctgttcatctacttcaggaatcagaaaggacgctctggacttcag
ccaacaggactcctgagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397732Help
Entry
100397732         CDS       T03264                                 

Gene name
caja-DRB
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-11 beta chain-like
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100397732 (caja-DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100397732 (caja-DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100397732 (caja-DRB)
   04612 Antigen processing and presentation
    100397732 (caja-DRB)
   04658 Th1 and Th2 cell differentiation
    100397732 (caja-DRB)
   04659 Th17 cell differentiation
    100397732 (caja-DRB)
   04672 Intestinal immune network for IgA production
    100397732 (caja-DRB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100397732 (caja-DRB)
   05322 Systemic lupus erythematosus
    100397732 (caja-DRB)
   05323 Rheumatoid arthritis
    100397732 (caja-DRB)
   05320 Autoimmune thyroid disease
    100397732 (caja-DRB)
   05321 Inflammatory bowel disease (IBD)
    100397732 (caja-DRB)
   05330 Allograft rejection
    100397732 (caja-DRB)
   05332 Graft-versus-host disease
    100397732 (caja-DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100397732 (caja-DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100397732 (caja-DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100397732 (caja-DRB)
   05152 Tuberculosis
    100397732 (caja-DRB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397732 (caja-DRB)
   05164 Influenza A
    100397732 (caja-DRB)
   05168 Herpes simplex virus 1 infection
    100397732 (caja-DRB)
   05169 Epstein-Barr virus infection
    100397732 (caja-DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100397732 (caja-DRB)
   05140 Leishmaniasis
    100397732 (caja-DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100397732 (caja-DRB)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100397732 (caja-DRB)
  Exosomal proteins of epithelial cells
   100397732 (caja-DRB)
  Exosomal proteins of breast milk
   100397732 (caja-DRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Motif
Other DBs
NCBI-GeneID: 100397732
NCBI-ProteinID: XP_008992456
UniProt: A0A2H1MYJ4
Position
4
AA seq 266 aa AA seqDB search
MVCLRLPGSSYIAALTVTLMALSSPLALAGDSPPRFLEQFKYECLHLNGTEGVRLLVRYI
YNQEEYVRFDSDVGEFRAVTELGRPAAEYFNSLKDYMEQTRAAVDTVCRHNYGIFERFLV
QRRVQPKVTVYPAKTQPLQRHNLLVCSVSGFYPGSIEVRWFRNDQEEKTGVVSTGLIHNG
DWTFQTLVMLETLPQSGEVYICQVEHPSVTSPLTVQWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSALRPSGVVS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgaggctccctggaagctcctacatagcagcgctgacagtgacactcatg
gcgctgagctccccactggctttggctggggactccccaccacgtttcttggagcagttt
aagtatgagtgtcttcacctcaacgggacggagggtgtacggctcctggtcagatacatc
tacaaccaggaggagtatgtgcgctttgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgccgcagagtacttcaacagcctgaaggactacatggagcagacg
cgggccgcggtggacaccgtgtgcagacacaactacgggatttttgagaggttcctagtg
cagaggcgagtccaacctaaggtgactgtgtatcctgcaaagacccagcccctgcagcgc
cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaacgaccaggaggagaagactggggtggtgtccacaggcctgatccacaatgga
gactggactttccagaccctggtgatgctggaaacacttcctcagagtggagaggtttac
atctgccaagtggagcacccaagcgtgaccagccctctcacagtgcaatggagagcacag
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggcgcagggctgttcatctacttcaggaatcagaaaggacattctgcccttcgg
ccatcaggagtcgttagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405222Help
Entry
100405222         CDS       T03264                                 

Gene name
Caja-DQB2
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 2 chain
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100405222 (Caja-DQB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100405222 (Caja-DQB2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100405222 (Caja-DQB2)
   04612 Antigen processing and presentation
    100405222 (Caja-DQB2)
   04658 Th1 and Th2 cell differentiation
    100405222 (Caja-DQB2)
   04659 Th17 cell differentiation
    100405222 (Caja-DQB2)
   04672 Intestinal immune network for IgA production
    100405222 (Caja-DQB2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100405222 (Caja-DQB2)
   05322 Systemic lupus erythematosus
    100405222 (Caja-DQB2)
   05323 Rheumatoid arthritis
    100405222 (Caja-DQB2)
   05320 Autoimmune thyroid disease
    100405222 (Caja-DQB2)
   05321 Inflammatory bowel disease (IBD)
    100405222 (Caja-DQB2)
   05330 Allograft rejection
    100405222 (Caja-DQB2)
   05332 Graft-versus-host disease
    100405222 (Caja-DQB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100405222 (Caja-DQB2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100405222 (Caja-DQB2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100405222 (Caja-DQB2)
   05152 Tuberculosis
    100405222 (Caja-DQB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100405222 (Caja-DQB2)
   05164 Influenza A
    100405222 (Caja-DQB2)
   05168 Herpes simplex virus 1 infection
    100405222 (Caja-DQB2)
   05169 Epstein-Barr virus infection
    100405222 (Caja-DQB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100405222 (Caja-DQB2)
   05140 Leishmaniasis
    100405222 (Caja-DQB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100405222 (Caja-DQB2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100405222 (Caja-DQB2)
  Exosomal proteins of epithelial cells
   100405222 (Caja-DQB2)
  Exosomal proteins of breast milk
   100405222 (Caja-DQB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I Ig_2
Motif
Other DBs
NCBI-GeneID: 100405222
NCBI-ProteinID: XP_008992469
Ensembl: ENSCJAG00000021548
Position
4
AA seq 264 aa AA seqDB search
MALQIPRGFRAAAVTLMLAMLSTPVADGRDSPKDFVVQFKGMCYFTNGTERVRGVARYIY
NREEYARFDSDVGEFRAVTELGRSTEDWNNYKDFLEQERAAVYTVCRHNYEAELRTTLQR
RVEPTVTISPTRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGIVSTSLIRNGDW
TYQILVMLEMTPQRGDIYTCHVEHPSLQSPITVEWRAHSESAQSKMLSGIGGFVLGLIFL
GLGLVIRHRGRKGPRGPPPAGLLH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcagatccctagaggctttcgggcagcagctgtgaccttgatgctggcgatg
ctgagcaccccagtggctgatggcagagactctcccaaggatttcgtggtccagtttaag
ggcatgtgctacttcaccaacgggacggagcgcgtgcggggtgtggccagatacatctat
aaccgcgaggagtacgcgcgcttcgacagcgacgtgggggagttccgggcggtgaccgag
ctggggcggagcaccgaggactggaacaactataaggacttcttggagcaggagcgggcc
gcggtgtacacggtgtgcagacacaactacgaggcggagctccgcacgaccttgcagcgc
cgagtggagcctacagtgaccatctccccaaccaggacagaggccctcaaccaccacaac
ctgctggtctgctccgtgacagatttctatccaggccagatcaaagtccggtggtttcgg
aatgaccaggaggagacagccggcattgtgtccacctccctcattaggaatggcgactgg
acataccagattctggtgatgctggaaatgactccccagcgtggggacatctacacctgc
catgtggagcaccccagcctccagagccccatcactgtggagtggcgggctcactccgaa
tctgcccagagcaagatgctgagtggaatcggaggctttgtgctggggctgatcttcctc
gggctgggccttgtcatccgtcacaggggtcggaaaggacctcgagggcctccccccgca
gggctcctgcactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407771Help
Entry
100407771         CDS       T03264                                 

Gene name
CAJA-DMA
Definition
(RefSeq) major histocompatibility complex, class II, DM alpha
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100407771 (CAJA-DMA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100407771 (CAJA-DMA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100407771 (CAJA-DMA)
   04612 Antigen processing and presentation
    100407771 (CAJA-DMA)
   04658 Th1 and Th2 cell differentiation
    100407771 (CAJA-DMA)
   04659 Th17 cell differentiation
    100407771 (CAJA-DMA)
   04672 Intestinal immune network for IgA production
    100407771 (CAJA-DMA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100407771 (CAJA-DMA)
   05322 Systemic lupus erythematosus
    100407771 (CAJA-DMA)
   05323 Rheumatoid arthritis
    100407771 (CAJA-DMA)
   05320 Autoimmune thyroid disease
    100407771 (CAJA-DMA)
   05321 Inflammatory bowel disease (IBD)
    100407771 (CAJA-DMA)
   05330 Allograft rejection
    100407771 (CAJA-DMA)
   05332 Graft-versus-host disease
    100407771 (CAJA-DMA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100407771 (CAJA-DMA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100407771 (CAJA-DMA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100407771 (CAJA-DMA)
   05152 Tuberculosis
    100407771 (CAJA-DMA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100407771 (CAJA-DMA)
   05164 Influenza A
    100407771 (CAJA-DMA)
   05168 Herpes simplex virus 1 infection
    100407771 (CAJA-DMA)
   05169 Epstein-Barr virus infection
    100407771 (CAJA-DMA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100407771 (CAJA-DMA)
   05140 Leishmaniasis
    100407771 (CAJA-DMA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100407771 (CAJA-DMA)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100407771 (CAJA-DMA)
  Exosomal proteins of epithelial cells
   100407771 (CAJA-DMA)
  Exosomal proteins of breast milk
   100407771 (CAJA-DMA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set SKG6
Motif
Other DBs
NCBI-GeneID: 100407771
NCBI-ProteinID: XP_002746456
Ensembl: ENSCJAG00000021559
Position
4
AA seq 260 aa AA seqDB search
MGHEQNQGAALLQMLPLLWLLPHSWAIPEAPTSVWRDDLQNHTFQHTVYCQDGSPSVGLS
ESYDEDQLFFFNFSENTRVPRLPEFADWAQEQRDAPAILFDKVFCQMMIRELEPIFDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGVGPTFVSAVD
GLSFQAFSYLNVTPEPSDIFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLG
VLGIIVGVVLIIYFRKPCSD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatgaacagaaccaaggagctgcgctgctacagatgctaccacttctgtggctg
ctgccccactcctgggccatccctgaagctcctacttcagtgtggcgggatgacctgcaa
aaccacacgttccagcacacagtgtactgccaggatgggagtcccagtgttggactctct
gagtcctacgatgaagaccagcttttcttcttcaacttttccgagaacactcgggtgcct
cgcctgcctgaatttgctgactgggctcaggaacagagagatgctcctgccattttattt
gacaaagtgttctgccagatgatgatccgggaactagagccaatatttgatgggaaaatc
ccggtgtccagagggtttcctatcgctgaggtgttcacgctgaagcccctggagtttggc
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac
tggcagcatcattccgtccctgtggaaggagttgggcctacttttgtctcagctgttgat
ggactcagcttccaggccttttcctacttaaatgtcacaccggaaccttctgacattttc
tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtgccccag
aatgcactgccctcagatctgctagagaatgtgctgtgtggtgtggcctttggcctgggt
gtgctgggcatcatcgtgggtgttgttctcatcatctacttccggaagccttgctcagac
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408132Help
Entry
100408132         CDS       T03264                                 

Gene name
CAJA-DOA
Definition
(RefSeq) major histocompatibility complex, class II, DO alpha
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100408132 (CAJA-DOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100408132 (CAJA-DOA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100408132 (CAJA-DOA)
   04612 Antigen processing and presentation
    100408132 (CAJA-DOA)
   04658 Th1 and Th2 cell differentiation
    100408132 (CAJA-DOA)
   04659 Th17 cell differentiation
    100408132 (CAJA-DOA)
   04672 Intestinal immune network for IgA production
    100408132 (CAJA-DOA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100408132 (CAJA-DOA)
   05322 Systemic lupus erythematosus
    100408132 (CAJA-DOA)
   05323 Rheumatoid arthritis
    100408132 (CAJA-DOA)
   05320 Autoimmune thyroid disease
    100408132 (CAJA-DOA)
   05321 Inflammatory bowel disease (IBD)
    100408132 (CAJA-DOA)
   05330 Allograft rejection
    100408132 (CAJA-DOA)
   05332 Graft-versus-host disease
    100408132 (CAJA-DOA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100408132 (CAJA-DOA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100408132 (CAJA-DOA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100408132 (CAJA-DOA)
   05152 Tuberculosis
    100408132 (CAJA-DOA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100408132 (CAJA-DOA)
   05164 Influenza A
    100408132 (CAJA-DOA)
   05168 Herpes simplex virus 1 infection
    100408132 (CAJA-DOA)
   05169 Epstein-Barr virus infection
    100408132 (CAJA-DOA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100408132 (CAJA-DOA)
   05140 Leishmaniasis
    100408132 (CAJA-DOA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408132 (CAJA-DOA)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100408132 (CAJA-DOA)
  Exosomal proteins of epithelial cells
   100408132 (CAJA-DOA)
  Exosomal proteins of breast milk
   100408132 (CAJA-DOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A ig
Motif
Other DBs
NCBI-GeneID: 100408132
NCBI-ProteinID: XP_002746457
Ensembl: ENSCJAG00000021571
UniProt: F7I2N8
Position
4
AA seq 250 aa AA seqDB search
MALRAGLVLGLYTLTTLLSLQEAGATKADHMGSYGPAFYQSYDASGQFTHEFDGEQLFSV
DLKKSEAGWRLPEFGDFARFDPQGGLASIAVIKAHLDVLVERSNRTRAINVPPRVTVLPK
SRVELGQPNVLICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHSFRKFHYLPFV
PLAEDVYDCQVEHWGLDTPLLRHWEPQVPTPPPDNMETLVCALGLAIGLVGFLVGTILII
MGICVSSAPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccctcagagcagggctggtcctggggctgtacaccctgaccaccctcctgagcctg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacgacgcctcgggccagttcacccatgagtttgatggggaacagctgttctctgtg
gacctgaagaaaagcgaggccgggtggcgtctgcctgagtttggcgactttgcccgcttt
gacccacagggtgggctggccagcatcgccgtgatcaaagctcatctggatgtcctggtg
gagcgctccaaccgtaccagggccatcaacgtgcctccacgggtgactgtgctccccaag
tcccgggtggagctgggccagcccaacgtcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggccaaactgtcactgagggagtggcccag
accagcttctactcccagcctgaccattcgttccgcaagttccactacctgccctttgtg
cccttggctgaggacgtctatgactgccaggtggagcactggggcctggacacaccgctg
ctcaggcattgggagccccaggtgcctactccaccgccagataacatggagaccctggtc
tgtgccctgggcctggccattggcttggtgggcttcctcgtgggcaccatcctcatcatc
atgggcatatgtgtgtccagtgcccccaggtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408503Help
Entry
100408503         CDS       T03264                                 

Gene name
CAJA-DPB1
Definition
(RefSeq) major histocompatibility complex, class II, DP beta 1
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100408503 (CAJA-DPB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100408503 (CAJA-DPB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100408503 (CAJA-DPB1)
   04612 Antigen processing and presentation
    100408503 (CAJA-DPB1)
   04658 Th1 and Th2 cell differentiation
    100408503 (CAJA-DPB1)
   04659 Th17 cell differentiation
    100408503 (CAJA-DPB1)
   04672 Intestinal immune network for IgA production
    100408503 (CAJA-DPB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100408503 (CAJA-DPB1)
   05322 Systemic lupus erythematosus
    100408503 (CAJA-DPB1)
   05323 Rheumatoid arthritis
    100408503 (CAJA-DPB1)
   05320 Autoimmune thyroid disease
    100408503 (CAJA-DPB1)
   05321 Inflammatory bowel disease (IBD)
    100408503 (CAJA-DPB1)
   05330 Allograft rejection
    100408503 (CAJA-DPB1)
   05332 Graft-versus-host disease
    100408503 (CAJA-DPB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100408503 (CAJA-DPB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100408503 (CAJA-DPB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100408503 (CAJA-DPB1)
   05152 Tuberculosis
    100408503 (CAJA-DPB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100408503 (CAJA-DPB1)
   05164 Influenza A
    100408503 (CAJA-DPB1)
   05168 Herpes simplex virus 1 infection
    100408503 (CAJA-DPB1)
   05169 Epstein-Barr virus infection
    100408503 (CAJA-DPB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100408503 (CAJA-DPB1)
   05140 Leishmaniasis
    100408503 (CAJA-DPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408503 (CAJA-DPB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100408503 (CAJA-DPB1)
  Exosomal proteins of epithelial cells
   100408503 (CAJA-DPB1)
  Exosomal proteins of breast milk
   100408503 (CAJA-DPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set ig Ig_3 Marek_A C2-set_2 Ig_2 MHC_I
Motif
Other DBs
NCBI-GeneID: 100408503
NCBI-ProteinID: XP_002746458
Ensembl: ENSCJAG00000021575
UniProt: F7ILZ1
Position
4
AA seq 257 aa AA seqDB search
MVLQVSALPRTVALTALLMALLTAVVQGRATTENYVYQRLFECYAFNGTQHLLDRLFYNR
EEFVRFDSDLGEYQAVTELGRPDAKYWNSQKDILEQMRAEVERVCRHNYELEDPLILKRQ
VQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWT
FQILVMLEMMPQQGDVYTCQVEHPSLDSPVTVEWKAQSDSARSKMLTGAGSFVLGLLICG
VGIVMHRRSKKVQRGSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcaggtttctgccctcccccggacagtggctctgacggcgttactgatggcg
ctactcacagctgtggtccagggcagggccactacagagaattacgtgtaccagagattg
tttgaatgctacgcgtttaacgggacacagcacctcctggacagactcttctacaaccgg
gaggagttcgtgcgtttcgatagcgacctgggggagtaccaggcggtgacagagctggga
cgtcccgatgccaagtactggaacagccagaaggacatcctggagcagatgcgggccgag
gtggagagggtgtgcagacacaactacgaattagaggatcccctcatcctgaagcgccaa
gtccagcctaaggtgaacgtctccccatccaagaaagggcccttgcaacaccacaacctg
cttgtctgccacgtgacagatttctacccgggcagcattcaagtccgatggttcctgaat
ggacaggaggaaacagctggggttgtgtccaccaacctgatccgtaatggagactggacc
ttccagatcctggtgatgctagaaatgatgccccagcagggagacgtctacacctgccaa
gtggagcaccccagtctggacagtcctgtcaccgtggagtggaaggcacagtctgattct
gcccggagtaagatgctgacaggagctgggagcttcgtgctggggctcctcatctgtgga
gtgggcatcgtcatgcacaggaggagcaaaaaagttcaacgaggatctgcgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410700Help
Entry
100410700         CDS       T03264                                 

Gene name
Caja-DRB, caja-DRB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-13 beta chain-like
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100410700 (Caja-DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100410700 (Caja-DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100410700 (Caja-DRB)
   04612 Antigen processing and presentation
    100410700 (Caja-DRB)
   04658 Th1 and Th2 cell differentiation
    100410700 (Caja-DRB)
   04659 Th17 cell differentiation
    100410700 (Caja-DRB)
   04672 Intestinal immune network for IgA production
    100410700 (Caja-DRB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100410700 (Caja-DRB)
   05322 Systemic lupus erythematosus
    100410700 (Caja-DRB)
   05323 Rheumatoid arthritis
    100410700 (Caja-DRB)
   05320 Autoimmune thyroid disease
    100410700 (Caja-DRB)
   05321 Inflammatory bowel disease (IBD)
    100410700 (Caja-DRB)
   05330 Allograft rejection
    100410700 (Caja-DRB)
   05332 Graft-versus-host disease
    100410700 (Caja-DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100410700 (Caja-DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100410700 (Caja-DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100410700 (Caja-DRB)
   05152 Tuberculosis
    100410700 (Caja-DRB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100410700 (Caja-DRB)
   05164 Influenza A
    100410700 (Caja-DRB)
   05168 Herpes simplex virus 1 infection
    100410700 (Caja-DRB)
   05169 Epstein-Barr virus infection
    100410700 (Caja-DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100410700 (Caja-DRB)
   05140 Leishmaniasis
    100410700 (Caja-DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100410700 (Caja-DRB)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100410700 (Caja-DRB)
  Exosomal proteins of epithelial cells
   100410700 (Caja-DRB)
  Exosomal proteins of breast milk
   100410700 (Caja-DRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set ig Ig_3 Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 100410700
NCBI-ProteinID: XP_002763912
Ensembl: ENSCJAG00000001687
Position
Un
AA seq 258 aa AA seqDB search
MVYMRLPGGSCMAVLTVMLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRLLERYI
HNQEENLRFDSDVGEFRAVTELGRPDAESWNSQKDFLEDRRAAVDTYCRHNYEISERFLV
PRRVQPKVTVYPAKAQPLQHHNLLVCSVSGFYPGSIEVRWFRNDQEEKTGVVSTGLIQNG
DWTFQTLVMLETLPQSGEVYTCQVEHPSVTSPLTVQWRAQSESAQSKMLSGVGGSVLGLL
FLGAGLFIYFRNQKGLLS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatatgaggctccctggaggctcctgcatggcagtgctgacagtgatgctgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttggagtatagc
acgtctgagtgtcatttcttcaacgggacggagcgggtgcggctcctggaaagatacatc
cataaccaggaggagaacttgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgacgcggagtcctggaacagccagaaggacttcctggaggacagg
cgggccgcggtggacacctactgcagacacaactacgagatttcagagaggttcctagtg
ccgcggagagtccaacctaaggtgactgtgtatcctgcaaaggcccagcccctgcagcac
cacaacctcctggtctgctctgtgagtgggttctatccaggcagcattgaagtcaggtgg
ttccggaacgaccaggaagagaagactggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacacttcctcagagtggagaggtttac
acctgccaagtggagcacccaagcgtgaccagccctctcacagtgcaatggagagcacag
tctgaatctgcacagagcaagatgctgagtggagtcgggggctctgtgctgggcctgctc
ttccttggggcagggctgttcatctacttcaggaatcagaaaggactcctgagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411388Help
Entry
100411388         CDS       T03264                                 

Gene name
Caja-DQA1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain-like
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100411388 (Caja-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100411388 (Caja-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100411388 (Caja-DQA1)
   04612 Antigen processing and presentation
    100411388 (Caja-DQA1)
   04658 Th1 and Th2 cell differentiation
    100411388 (Caja-DQA1)
   04659 Th17 cell differentiation
    100411388 (Caja-DQA1)
   04672 Intestinal immune network for IgA production
    100411388 (Caja-DQA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100411388 (Caja-DQA1)
   05322 Systemic lupus erythematosus
    100411388 (Caja-DQA1)
   05323 Rheumatoid arthritis
    100411388 (Caja-DQA1)
   05320 Autoimmune thyroid disease
    100411388 (Caja-DQA1)
   05321 Inflammatory bowel disease (IBD)
    100411388 (Caja-DQA1)
   05330 Allograft rejection
    100411388 (Caja-DQA1)
   05332 Graft-versus-host disease
    100411388 (Caja-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100411388 (Caja-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100411388 (Caja-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100411388 (Caja-DQA1)
   05152 Tuberculosis
    100411388 (Caja-DQA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100411388 (Caja-DQA1)
   05164 Influenza A
    100411388 (Caja-DQA1)
   05168 Herpes simplex virus 1 infection
    100411388 (Caja-DQA1)
   05169 Epstein-Barr virus infection
    100411388 (Caja-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100411388 (Caja-DQA1)
   05140 Leishmaniasis
    100411388 (Caja-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100411388 (Caja-DQA1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100411388 (Caja-DQA1)
  Exosomal proteins of epithelial cells
   100411388 (Caja-DQA1)
  Exosomal proteins of breast milk
   100411388 (Caja-DQA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A
Motif
Other DBs
NCBI-GeneID: 100411388
NCBI-ProteinID: XP_002746461
Ensembl: ENSCJAG00000001629
Position
4
AA seq 259 aa AA seqDB search
MILNKALMLGALVLTTVLTTVMSPCGGEDIAADHVASYGVNLYQSYGPSGQFTHEFDGDE
EFYVDLGKKETVWRLPVFSTFTSFDPQGALTNIATMKPGLDILIKRSNCTAATNEVPEVT
VFSKSPVALGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVTETSFLSKSDHSFFKISY
LTFLPSADEIYDCEVEHWGLDEPLLKHWEPEISPPVSELTETVVCTLGLSVGLVGIVVGT
VFIIRGLRSVGASRRQGIL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgatgctgggggccctcgtcctgaccaccgtcctgaccacc
gtgatgagcccctgtggaggtgaagacattgcggctgaccacgttgcctcttatggtgta
aacttgtaccagtcttatggtccctctggccagttcacccatgaattcgatggagacgag
gagttctacgtggacctagggaaaaaggagactgtctggcgattgcctgtgttcagcaca
tttacaagttttgacccacagggcgcactgacaaacatcgctacgatgaaacccggcttg
gacatcctgattaaacgctccaactgtaccgctgctaccaatgaggttcctgaggtcaca
gtgttttccaagtctcctgtggcgctgggtcagcccaacaccctcatctgccttgtggac
aacatcttccctcccgtggtcaacatcacatggctgagcaatgggcactcagtcacagaa
ggtgttactgagaccagcttcctctccaagagtgatcattccttctttaagatcagttac
ctcaccttcctcccttccgctgatgagatttatgactgcgaggtggagcactggggcctg
gacgagcctcttctgaaacactgggagcctgagatttcaccccctgtgtcagagctcaca
gagactgtggtctgcaccctggggttgtctgtgggcctcgtgggcattgtggtgggcacc
gtcttcatcatccgaggcctgcgttcagttggtgcttccagacgccaagggatcttgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412691Help
Entry
100412691         CDS       T03264                                 

Gene name
CAJA-DMB
Definition
(RefSeq) major histocompatibility complex, class II, DM beta
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100412691 (CAJA-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100412691 (CAJA-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100412691 (CAJA-DMB)
   04612 Antigen processing and presentation
    100412691 (CAJA-DMB)
   04658 Th1 and Th2 cell differentiation
    100412691 (CAJA-DMB)
   04659 Th17 cell differentiation
    100412691 (CAJA-DMB)
   04672 Intestinal immune network for IgA production
    100412691 (CAJA-DMB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100412691 (CAJA-DMB)
   05322 Systemic lupus erythematosus
    100412691 (CAJA-DMB)
   05323 Rheumatoid arthritis
    100412691 (CAJA-DMB)
   05320 Autoimmune thyroid disease
    100412691 (CAJA-DMB)
   05321 Inflammatory bowel disease (IBD)
    100412691 (CAJA-DMB)
   05330 Allograft rejection
    100412691 (CAJA-DMB)
   05332 Graft-versus-host disease
    100412691 (CAJA-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100412691 (CAJA-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100412691 (CAJA-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100412691 (CAJA-DMB)
   05152 Tuberculosis
    100412691 (CAJA-DMB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100412691 (CAJA-DMB)
   05164 Influenza A
    100412691 (CAJA-DMB)
   05168 Herpes simplex virus 1 infection
    100412691 (CAJA-DMB)
   05169 Epstein-Barr virus infection
    100412691 (CAJA-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100412691 (CAJA-DMB)
   05140 Leishmaniasis
    100412691 (CAJA-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100412691 (CAJA-DMB)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100412691 (CAJA-DMB)
  Exosomal proteins of epithelial cells
   100412691 (CAJA-DMB)
  Exosomal proteins of breast milk
   100412691 (CAJA-DMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set ig
Motif
Other DBs
NCBI-GeneID: 100412691
NCBI-ProteinID: XP_002746464
Ensembl: ENSCJAG00000021558
Position
4
AA seq 263 aa AA seqDB search
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDDGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNQLANGLSDYLNKQDTLMQRLRNGLQDCATHTQPFWGSLTHRTRPPSVQVA
RTTPFNTREPVMLACYVWGFYPADVIITWRKNGKPVIPHSSAQKTAQPNGDWTYQTLSHL
ALTPSYGDIYTCVVEHIGAPEPILQAGTPGLSPMQTVKVSVSAVTLGLGLIIFSLGLISW
RRAGSSSYIPLPGSNYPEARHIS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatcacattcctgccactgctgctggggctcagcctgggctgcaccggagcaggtggc
ttcgtggcccatgtggaaagcacctgtctgttggatgatgatgggacgccaaaggatttc
acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaacaag
atggccccttgcgaatttggggtgctgaatcagttggccaatggcttatcagattacctc
aacaaacaagacaccctgatgcagcgcttgcgcaatgggcttcaggattgtgccacacat
acccagcccttctggggatcactgacccacaggacacggccaccatctgtgcaagtagcc
cgaaccactccttttaacacgagggagcctgtgatgctggcctgctacgtgtggggcttt
tatccagcagatgtgatcatcacgtggaggaagaacgggaagcctgtcattcctcatagc
agtgcccagaagactgcccagcccaatggagactggacataccagaccctctctcattta
gccttaaccccctcttacggggacatctacacctgtgtggtggagcacattggggctcct
gagcccatccttcaggccgggacacctgggctgtcccccatgcagacagtgaaggtttct
gtgtctgcagtgacgttgggcctgggcctcatcatcttctctcttggtttgatcagctgg
cggagggctggctcctctagctacattcctcttcctgggtccaattatccggaagcacgg
cacatttcctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413648Help
Entry
100413648         CDS       T03264                                 

Gene name
CAJA-DPA1
Definition
(RefSeq) major histocompatibility complex, class II, DP alpha 1
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100413648 (CAJA-DPA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100413648 (CAJA-DPA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100413648 (CAJA-DPA1)
   04612 Antigen processing and presentation
    100413648 (CAJA-DPA1)
   04658 Th1 and Th2 cell differentiation
    100413648 (CAJA-DPA1)
   04659 Th17 cell differentiation
    100413648 (CAJA-DPA1)
   04672 Intestinal immune network for IgA production
    100413648 (CAJA-DPA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100413648 (CAJA-DPA1)
   05322 Systemic lupus erythematosus
    100413648 (CAJA-DPA1)
   05323 Rheumatoid arthritis
    100413648 (CAJA-DPA1)
   05320 Autoimmune thyroid disease
    100413648 (CAJA-DPA1)
   05321 Inflammatory bowel disease (IBD)
    100413648 (CAJA-DPA1)
   05330 Allograft rejection
    100413648 (CAJA-DPA1)
   05332 Graft-versus-host disease
    100413648 (CAJA-DPA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100413648 (CAJA-DPA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100413648 (CAJA-DPA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100413648 (CAJA-DPA1)
   05152 Tuberculosis
    100413648 (CAJA-DPA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100413648 (CAJA-DPA1)
   05164 Influenza A
    100413648 (CAJA-DPA1)
   05168 Herpes simplex virus 1 infection
    100413648 (CAJA-DPA1)
   05169 Epstein-Barr virus infection
    100413648 (CAJA-DPA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100413648 (CAJA-DPA1)
   05140 Leishmaniasis
    100413648 (CAJA-DPA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100413648 (CAJA-DPA1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100413648 (CAJA-DPA1)
  Exosomal proteins of epithelial cells
   100413648 (CAJA-DPA1)
  Exosomal proteins of breast milk
   100413648 (CAJA-DPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Motif
Other DBs
NCBI-GeneID: 100413648
NCBI-ProteinID: XP_002746467
Ensembl: ENSCJAG00000021573
UniProt: A0A2R8MUF5
Position
4
AA seq 260 aa AA seqDB search
MHPEDRVFQIRAVILRAFSLAFLLSLRGAGAIKADHVSTFVMFVQTQRPTGEFVFEFDKD
EIFHVDLDKKETVWRLEEFGRAYSFEVQGGLANIAALNYNLNIMIQRSNHTQATNDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGQPVTEGVAESVFLPGTDGSFHKFH
YLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIMG
TILIIKSLRSGRDPRAQGPL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctgaagacagagtcttccagatcagagctgtgatcttgagagccttctccttg
gctttcctgctgagtctccgaggggctggggccatcaaagcggaccatgtgtcaactttt
gtcatgtttgtacagacgcagagaccaacaggggagtttgtgtttgagtttgataaggat
gagatattccatgtggatctggacaagaaggagaccgtgtggcgtctggaggagtttggc
cgagcctattcctttgaggttcagggcgggctggctaacattgctgcattgaactacaac
ttgaatatcatgatccagcgttccaaccacactcaggccaccaatgatccccctgaagtg
accgtgtttcccaaggagcctgtggagctgggccagcccaataccctcatctgccacatt
gacaagttcttcccaccggtgctcaatgtcacttggctgtgcaatgggcagccggtcact
gagggtgtcgctgagagcgtcttcctgcctggaacagatggcagcttccacaagttccat
tacctgacctttgtgccctcagctgaggatgtctatgactgcagggtggagcactggggc
ttggaccagccactcctcaaacactgggaggcccaagagccaatccagatgcctgagacg
acggagactgtgctctgtgccctgggccttgtcttggggctagtgggcatcatcatgggc
accatcctcatcataaaatctctgcgttctggccgtgacccccgggcccaggggcccctg
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103792390Help
Entry
103792390         CDS       T03264                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    103792390
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103792390
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103792390
   04612 Antigen processing and presentation
    103792390
   04658 Th1 and Th2 cell differentiation
    103792390
   04659 Th17 cell differentiation
    103792390
   04672 Intestinal immune network for IgA production
    103792390
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    103792390
   05322 Systemic lupus erythematosus
    103792390
   05323 Rheumatoid arthritis
    103792390
   05320 Autoimmune thyroid disease
    103792390
   05321 Inflammatory bowel disease (IBD)
    103792390
   05330 Allograft rejection
    103792390
   05332 Graft-versus-host disease
    103792390
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103792390
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103792390
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    103792390
   05152 Tuberculosis
    103792390
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103792390
   05164 Influenza A
    103792390
   05168 Herpes simplex virus 1 infection
    103792390
   05169 Epstein-Barr virus infection
    103792390
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103792390
   05140 Leishmaniasis
    103792390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    103792390
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103792390
  Exosomal proteins of epithelial cells
   103792390
  Exosomal proteins of breast milk
   103792390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set ig
Motif
Other DBs
NCBI-GeneID: 103792390
NCBI-ProteinID: XP_008992503
Position
4
AA seq 172 aa AA seqDB search
MSHFSSFLVQPEVTVYPERTPLLHQHNLLLCSVTGFYPGDIKIRWFLNGQEERVGVLSTG
LIGNGDWTFQTVVMLEMTPELGDVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAGF
LFGLIFLLVGIVIQLRAQKGLKSCSAASVILKSSWKLLSLEPKVVMGSLGPG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatttctcttccttcctagtgcaaccagaggtgacggtgtacccagagaggacc
ccactcctgcaccagcataatctgctgctctgctctgtgacgggcttctatccaggggac
atcaagatcaggtggttcctgaatgggcaggaggagagagttggggtcctgtccactggc
cttatcgggaatggagactggacctttcagactgtggtgatgctggaaatgactcctgaa
cttggagacgtctacacctgccttgtcgatcattccagcctgctgagccctgtttctgtg
gagtggagagctcagtctgaatattcttggagaaagatgctgagtggcattgcaggcttc
ctatttgggctaatcttccttctggtggggatcgtcatccagctcagggctcagaaaggt
ctcaagagctgttctgctgcctcagtcatactaaagtcctcatggaagcttctctccctg
gagcctaaagtagtgatgggtagtctgggccctgggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108591149Help
Entry
108591149         CDS       T03264                                 

Gene name
Caja-DQB1, DQB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04612  Antigen processing and presentation
cjc04640  Hematopoietic cell lineage
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    108591149 (Caja-DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108591149 (Caja-DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108591149 (Caja-DQB1)
   04612 Antigen processing and presentation
    108591149 (Caja-DQB1)
   04658 Th1 and Th2 cell differentiation
    108591149 (Caja-DQB1)
   04659 Th17 cell differentiation
    108591149 (Caja-DQB1)
   04672 Intestinal immune network for IgA production
    108591149 (Caja-DQB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108591149 (Caja-DQB1)
   05322 Systemic lupus erythematosus
    108591149 (Caja-DQB1)
   05323 Rheumatoid arthritis
    108591149 (Caja-DQB1)
   05320 Autoimmune thyroid disease
    108591149 (Caja-DQB1)
   05321 Inflammatory bowel disease (IBD)
    108591149 (Caja-DQB1)
   05330 Allograft rejection
    108591149 (Caja-DQB1)
   05332 Graft-versus-host disease
    108591149 (Caja-DQB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108591149 (Caja-DQB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108591149 (Caja-DQB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108591149 (Caja-DQB1)
   05152 Tuberculosis
    108591149 (Caja-DQB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108591149 (Caja-DQB1)
   05164 Influenza A
    108591149 (Caja-DQB1)
   05168 Herpes simplex virus 1 infection
    108591149 (Caja-DQB1)
   05169 Epstein-Barr virus infection
    108591149 (Caja-DQB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108591149 (Caja-DQB1)
   05140 Leishmaniasis
    108591149 (Caja-DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    108591149 (Caja-DQB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108591149 (Caja-DQB1)
  Exosomal proteins of epithelial cells
   108591149 (Caja-DQB1)
  Exosomal proteins of breast milk
   108591149 (Caja-DQB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Marek_A C2-set_2
Motif
Other DBs
NCBI-GeneID: 108591149
NCBI-ProteinID: XP_017826495
Ensembl: ENSCJAG00000021548
Position
4
AA seq 267 aa AA seqDB search
MSIIFLDAWKMALQIPGGLWAAAVTLMLAMLSTPVAEGRDSPQDFVYQVKGMCYFRNGTE
RVRLVTRFIYNREEYLRFDSDVGEYLPVTPLGPPDAEYLNSQKDLLDRTRAELDTVCRHN
YQLEFPAILQRREKPTVTISSSRREALNHHNLLVCSVTDFYPGQIKVRWFQNDQEQSAGI
VSTPLIRNGDWTFQILVMLEMTPQHGDIYICHVEHPSLQSPITVEWRAQSESAQRKMLSG
IGGFVLGLIFLGLGFIIHHRSQKGLLH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcatcttccttgatgcttggaagatggctctgcagatccctggaggcttgtgg
gcagcagctgtgaccttgatgctggcgatgctgagcaccccagtggctgagggcagagac
tctccccaggatttcgtgtaccaggttaagggcatgtgctacttcaggaacgggacggag
cgcgtgcgccttgtgacccgattcatctataaccgagaggagtacctgcgcttcgacagc
gacgtgggggagtacctgccggtgacgccgctggggccgccggatgctgagtacttgaac
agccagaaggacttactggacaggacccgggcggagctggacacggtgtgcagacacaac
taccagctggagttccccgcgatcttgcagcggcgagagaagcctacagtgaccatctcc
tcatccaggagagaggccctcaatcaccacaacctgctggtctgctcggtgacagatttc
tatccaggccagatcaaagtccggtggtttcagaatgaccaggagcagtcagccggtatt
gtgtccactccccttatcaggaatggtgactggaccttccagatcctggtgatgctggaa
atgactccccagcatggagacatctacatctgccacgtggagcaccccagcctccagagc
cccatcaccgtggagtggcgggctcagtctgaatctgcccagcgcaagatgctgagtggc
attggaggcttcgtgctcgggctgatcttcctcgggctgggctttatcatccatcacagg
agtcagaaagggctcctgcactga

DBGET integrated database retrieval system