KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385438Help
Entry
100385438         CDS       T03264                                 

Gene name
ALDH3A1
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100385438 (ALDH3A1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100385438 (ALDH3A1)
   00350 Tyrosine metabolism
    100385438 (ALDH3A1)
   00360 Phenylalanine metabolism
    100385438 (ALDH3A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100385438 (ALDH3A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100385438 (ALDH3A1)
   00982 Drug metabolism - cytochrome P450
    100385438 (ALDH3A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100385438 (ALDH3A1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     100385438 (ALDH3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100385438
NCBI-ProteinID: XP_008995007
Ensembl: ENSCJAG00000011784
UniProt: F6YGX5
Position
5
AA seq 453 aa AA seqDB search
MSQISETVRRARAAFNSGRTRPLQFRIQQLEALRRMIQEREQELAGALAADLHKSEWTAY
YEEVVYVLEEIEYMIQKLPEWASDEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKELYPVINGGVPETTELLKER
FDHILYTGSTGVGKIVMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKYMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAASRYIAPTILTDVDPQSPVMQEEIFGPVMPIVCMRSLEDAIQFINQHEK
PLALYVFSSNDKVIKKMIAETSSGGVTANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRSLMNDESLKARYPPSPAKMTRH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatcagcgagaccgtgaggcgcgcccgcgccgccttcaactcgggccggacc
cgccccctgcagttccggatccagcagctggaggcgctgcggcgcatgatccaggagcgc
gagcaggagctggcgggagcgctggccgcggatctgcacaagagtgaatggaccgcctac
tatgaggaggtggtgtacgtcctggaggagattgagtacatgatccagaagctccctgag
tgggcctcggacgagcctgtggagaagacgccccagacccagcaggacgagctctacatc
cactcggagccgctaggtgtggtcctggtcatcggcacctggaactaccccttcaacctc
accatccagcccatggtgggtgccattgctgcagggaatgcagtggtcctcaagccctcg
gagctgagtgagaacatggcgagcctgctggctaccatcatcccccaatacctggacaag
gaactgtacccagtaatcaacgggggtgtccctgagaccacggagctgctcaaggagagg
ttcgaccacatcctgtacacaggcagcacaggggtggggaagattgtcatgacggctgct
gccaagcacctgacccctgtcacactggagctgggagggaagagtccctgctacgtggac
aagaactgcgacctggatgtggcttgccgacgcatcgcctgggggaaatacatgaacagc
ggccagacctgtgtggcccccgactacatcctctgtgacccctcgatccagaaccaaata
gtggagaagctcaagaagtcactgaaagagttctatggggaagatgccaagaaatcccgg
gattatggaagaatcattagtgcccggcacttccagagggtgatgggcctgattgagggc
cagaaggtagcttacgggggcaccggggatgcggcctcccgctacatagcgcccaccatc
ctcacggacgtggacccccagtccccagtgatgcaagaggagatcttcgggcctgtgatg
cccattgtgtgcatgcgcagcctagaggatgccatccagttcatcaaccagcacgagaag
cccctggccctctacgtgttctccagcaacgacaaggtgattaagaagatgattgcagag
acatccagtggtggggtgacggccaacgatgtcatcgtccacatcaccttgcactctctg
ccctttgggggcgtggggaacagtggcatggggtcctaccatggcaagaagagctttgag
accttctctcaccgccgctcttgcctggtgaggtctctgatgaatgatgaatccttgaaa
gccagataccccccaagcccagccaagatgacccggcactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397394Help
Entry
100397394         CDS       T03264                                 

Gene name
ALDH1A3
Definition
(RefSeq) aldehyde dehydrogenase 1 family member A3
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100397394 (ALDH1A3)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100397394 (ALDH1A3)
   00350 Tyrosine metabolism
    100397394 (ALDH1A3)
   00360 Phenylalanine metabolism
    100397394 (ALDH1A3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100397394 (ALDH1A3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100397394 (ALDH1A3)
   00982 Drug metabolism - cytochrome P450
    100397394 (ALDH1A3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100397394 (ALDH1A3)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     100397394 (ALDH1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100397394
NCBI-ProteinID: XP_002749112
Ensembl: ENSCJAG00000017159
Position
6
AA seq 512 aa AA seqDB search
MATTNGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKMAPALCCGNTMVLKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYAEFVRRSVEYARKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAVEDRGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFRSIEEVIQRANSTDYGLTAAVFTKNLDKALTLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGNKNP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccaccactaacggggccgtggaaaatgggcagccggacaggaagcctccagccctg
ccgcgccccatccgcaacctggaggtcaagttcaccaagatatttatcaacaatgaatgg
cacgaatccaagagtggaaaaaagtttgccacatataacccttcaactctggagaaaata
tgtgaagtggaagaaggagataagcccgacgtggacaaggctgtggaggccgcacaggcc
gccttccagagaggctcgccgtggcgccggctggatgccctgagtcgcgggcggctgctg
caccagctggctgacctggtggagagggaccgcgccaccctggccgccctggagacgatg
gatactgggaagccgtttctccatgcctttttcatcgacctggagggctgtattagaacc
ctcagatactttgcagggtgggcagacaaaatccagggcaagaccatccccacagatgac
aacgtcgtgtgcttcaccaggcatgagcccattggtgtctgtggggccatcactccgtgg
aacttccccctgctgatgctggtgtggaagatggcacccgccctctgctgtgggaacacc
atggtcctgaagcccgcggagcagacacccctcactgccctttatctcggctctctgatc
aaagaggtcgggttccccccaggagtggtgaacattgtgccaggattcgggcccacagtg
ggagcagcaatttcttctcaccctcagatcaacaagatcgccttcaccgggtccacagag
gttggaaagctggttaaagaagccgcctcccggagcaatctgaagcgggtgacgctggag
ctgggggggaagaacccctgcatcgtgtgcgctgacgctgacttggacttggcagtggag
tgtgcccatcagggagtgttcttcaaccagggccagtgctgcacagccgcctcgagggtg
ttcgtggaggagcaggtctacgccgagtttgtcaggcggagcgtggagtatgcccggaaa
cggcctgtaggagaccccttcgatgtcaaaacagagcaggggcctcagattgatcagaag
cagttcgacaaaatcctagaactgatcgagagtgggaagaaggaaggggccaagctggaa
tgcgggggctcggccgtggaagacaggggactcttcatcaaacccactgtcttctcagaa
gtcacggacaacatgcggattgccaaagaggagattttcgggccagtgcaaccaatactg
aagttcagaagtatcgaagaagtgatacaaagagcaaatagcactgactatggactcaca
gcagccgtgttcacaaagaaccttgacaaagccctgacgctggcttctgccttagagtct
ggaacagtctggatcaactgctacaacgctctctatgcacaggctccatttggtggcttt
aaaatgtcaggaaatggcagagaactaggtgaatatgccttggccgaatacacagaagtg
aaaactgtcaccatcaaacttggcaacaagaacccctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399356Help
Entry
100399356         CDS       T03264                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100399356
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100399356
   00350 Tyrosine metabolism
    100399356
   00360 Phenylalanine metabolism
    100399356
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100399356
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100399356
   00982 Drug metabolism - cytochrome P450
    100399356
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100399356
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     100399356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100399356
NCBI-ProteinID: XP_002755671
Ensembl: ENSCJAG00000003697
Position
11
AA seq 488 aa AA seqDB search
MSKEEGGSAVKGPGAESTLGTDPFEDTLRRLREAFHSGCTRPAAFRAEQLQALGRFLQEN
KQLLHDALAQDLHKSAFDSDISELIISQNEINLALKNLQAWMKDTPASTNLFTKLDSAFV
RKEPFGLVLIIAPWNYPINLTLVPLVGALAAGNCVVLKPSEISQGTEKVLAEVLPRYLDQ
SCFAVVLGGPEETGQLLKHKFDYIFFTGSPHVGKIVRTAAAKHLTPVTLELGGKNPCYVD
DDCDPQIVANRVAWFRYFIAGQTCVAPDYLLCSPEMQERLLPALQSAITRFYGDDPQSSP
NLGRIINQKQFQRLRALLGCGRVAIGGQSDECDRYIAPTVLVDVQETEPVMQEEIFGPIL
PIMNVQGMDEAIEFINRREKPLALYAFSNSSQVVRRILAQTSSGGFCGNDGFMHMTLASL
PFGGVGASGIGRYHGKFSFDTFSHHRACLLRSPGMEKLNAIRYPPHSPRRLRVLLVAMEA
RGCSCTLL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggaagagggtggaagtgcggtgaagggcccgggagcagagtccacactgggg
acggacccctttgaggacacgctgcggcgactgagggaggccttccactcggggtgcact
cggccggccgcgttccgggctgagcaactccaggctctcggccgcttccttcaagaaaac
aagcagcttctgcacgacgcgctggcccaggacctgcacaagtcagccttcgattcagac
atatctgagctcatcattagccagaatgagatcaacctcgctctcaagaacctgcaggcc
tggatgaaggacacgccagcgtccacaaacttgttcacaaagttggactcagccttcgtc
cggaaggagccctttggcctggtcctcatcatcgcaccctggaactaccccattaacctc
accctggtgcccctggtgggcgctctcgccgcagggaactgcgtggtgctgaaaccatca
gaaatcagtcagggcacagagaaggtcttggctgaggtgctgccacggtacctggaccag
agttgctttgccgtggtgctgggcgggcctgaggagacggggcagctgctgaagcacaag
ttcgactacatcttcttcacggggagccctcacgtgggcaagattgtcaggacggctgca
gccaagcacctgacgcctgtcaccctggagctagggggcaagaacccctgctatgtggac
gacgactgcgacccccagatcgtggccaaccgcgtggcctggttccgctacttcatcgcc
ggtcagacctgcgtggcccctgactacctcctgtgtagccctgagatgcaggagaggctg
ctgcccgccctgcagagcgccatcacccgtttctatggcgacgacccccagagctcccca
aatctgggccgcatcatcaaccagaaacagttccagcggctgcgggcactgctgggctgc
ggccgcgtggccatcgggggccagagcgacgagtgcgatcgctacatcgcccccacggtg
ctggtggatgtgcaggagacggagccggtgatgcaggaggagatcttcgggcccatccta
cccatcatgaacgtgcagggcatggacgaggccatcgagttcatcaaccggagggagaag
cccctggccctgtacgccttctccaacagcagccaggtggtcaggcggatactggcccag
accagcagcgggggcttctgcgggaacgacggcttcatgcacatgaccctggccagcctg
cctttcggaggagtgggtgccagcgggataggccggtaccacggcaagttctccttcgac
actttctcccaccatcgtgcctgcctcctgcgcagcccagggatggaaaagctcaatgcc
atccgctaccctccccactcaccgcgccgcctgagggtgctgctggtggccatggaggcc
cgaggctgcagctgcacgctgctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405175Help
Entry
100405175         CDS       T03264                                 

Gene name
ALDH3B1
Definition
(RefSeq) aldehyde dehydrogenase 3 family member B1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100405175 (ALDH3B1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100405175 (ALDH3B1)
   00350 Tyrosine metabolism
    100405175 (ALDH3B1)
   00360 Phenylalanine metabolism
    100405175 (ALDH3B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100405175 (ALDH3B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100405175 (ALDH3B1)
   00982 Drug metabolism - cytochrome P450
    100405175 (ALDH3B1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100405175 (ALDH3B1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     100405175 (ALDH3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 100405175
NCBI-ProteinID: XP_017833810
UniProt: U3DQQ2
Position
11
AA seq 468 aa AA seqDB search
MDPFEDTLRRLRETFHAGHTRPAEFRAAQLRGLGHFLQDNKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNLRAWMKDEHVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKSIEKVLAEELPRYLDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQIVANRVAWFRYFNA
GQTCVAPDYLLCSPEMQERLLPALQSAITRFYGNDPQSSPNLGRIINQKQFQRLRALLGC
GRVAIGGQSDECDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVRGVDEAIEFINRREK
PLALYAFSNSSQVVRRILAQTSSGGFCGNDGFMHMTLASLPFGGVGASGIGRYHGKFSFD
TFSHHRACLLRSPGMEKLNAIRYPPHSPRRLRVLLVAMEARGCSCTLL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaccccttcgaggacacgctgcggcggctgcgggaaaccttccacgcggggcacacg
cggccggccgagttccgggctgcacagctccggggactgggccacttcctgcaggacaac
aagcagcttctgcatgatgccctggcccaggacctgcacaagtcagccttcgagtcagag
gtgtctgaggtcgccatcagccagggtgaggtcaccctggccctcaggaacctccgggcc
tggatgaaggacgagcatgtgcccaagaacctggccacacagctggactcagccttcatc
cggaaggagccctttggcctggtcctcatcattgcgccctggaactaccccctgaacctg
acgctggtgcccctagtgggtgccctcgctgcagggaactgtgtggtgctgaagccgtca
gagattagcaagagcatagagaaggttctggccgaggagctgccccgatacctggaccag
agctgctttgccgtggtgctgggtgggccccaggagacggggcagctgctggagcacagg
ttcgactacatcttcttcacagggagccctcgcgtgggcaagattgtcatgacggctgcc
gccaagcacctgacgcccgtcaccctggagctggggggcaagaacccctgctatgtggac
gataactgtgacccccagatcgtggccaaccgcgtggcctggttccgctacttcaacgcc
ggccagacctgcgtggcccctgactacctcctgtgtagccctgagatgcaggagaggctg
ctgcccgccctgcagagcgccatcacccgtttctatggcaacgacccccagagctcccca
aatctgggccgcatcatcaaccagaaacagttccagcggctgcgggcactgctgggctgc
ggccgcgtggccatcgggggacagagcgacgagtgcgatcgctacatcgcccccacggtg
ctggtggatgtgcaggagacggagccggtgatgcaggaagagattttcgggcccatcctg
cccatcgtgaatgtgcggggcgtggacgaggccatcgagttcatcaaccggagggagaag
cccctggccctgtacgccttctccaacagcagccaggtggtcaggcggatactggcccag
accagcagcgggggcttctgcgggaacgacggcttcatgcacatgaccctggccagcctg
cctttcggaggagtgggtgccagcgggataggccggtaccacggcaagttctccttcgac
actttctcccaccatcgtgcctgcctcctgcgcagcccagggatggaaaagctcaatgcc
atccgctaccctccccactcaccgcgccgcctgagggtgctgctggtggccatggaggcc
cgaggctgcagctgcacgctgctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408282Help
Entry
100408282         CDS       T03264                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1-like
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100408282
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100408282
   00350 Tyrosine metabolism
    100408282
   00360 Phenylalanine metabolism
    100408282
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100408282
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100408282
   00982 Drug metabolism - cytochrome P450
    100408282
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100408282
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     100408282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Zn_Tnp_IS91
Motif
Other DBs
NCBI-GeneID: 100408282
NCBI-ProteinID: XP_008988739
Position
11
AA seq 145 aa AA seqDB search
MTAAAKHLTPVTLELGGKNPCYVDDNCDPQIVANRVAWFRYFNAGQTCVAPDYLLCSPEM
QERLLPALQSAITRFYGNDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSDECDRYI
GESCCPRHSPRGPRAHLIGGPTAGP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgccgccaagcacctgacacccgtcaccctggagctggggggcaagaacccc
tgctatgtggacgataactgtgacccccagatcgtggccaaccgcgtggcctggttccgc
tacttcaacgccggccagacctgcgtggcccctgactacctcctgtgtagccctgagatg
caggagaggctgctgcccgccctgcagagcgccatcacccgtttctatggcaacgacccc
cagagctccccaaatctgggccgcatcatcaaccagaaacagttccagcggctgcgggca
ctgctgggctgcggccgcgtggccatcgggggacagagcgacgagtgcgatcgctacatc
ggtgagtcctgctgtccccgccacagcccacgtgggccgagagcccacctcattggaggg
cccacagctgggccatga

DBGET integrated database retrieval system