KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385441Help
Entry
100385441         CDS       T03264                                 

Gene name
CCL4
Definition
(RefSeq) C-C motif chemokine 4-like
  KO
K12964  C-C motif chemokine 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05132  Salmonella infection
cjc05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100385441 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100385441 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100385441 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    100385441 (CCL4)
   04062 Chemokine signaling pathway
    100385441 (CCL4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100385441 (CCL4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100385441 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100385441 (CCL4)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100385441 (CCL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100385441
NCBI-ProteinID: XP_002748376
Ensembl: ENSCJAG00000015060
UniProt: U3F7H0
Position
5
AA seq 92 aa AA seqDB search
MKLCMTVLSLLVLVAAFCSPALSAPMGSDPPTACCFSYTVRKLPRNFVVDYFETSSLCSQ
PAVVFQTKRGKQVCADPSETWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcatgactgtcctgtctctcctcgtgctagtagctgccttctgctctcca
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacactgtg
agaaagcttcctcgcaactttgtggtagattacttcgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaggcaagcaagtctgtgccgaccccagtgagacc
tgggtccaggagtatgtgtatgacctggaactgaactga

DBGET integrated database retrieval system