KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385454Help
Entry
100385454         CDS       T03264                                 

Definition
(RefSeq) actin-3-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100385454
   04390 Hippo signaling pathway
    100385454
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100385454
  09143 Cell growth and death
   04210 Apoptosis
    100385454
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100385454
   04520 Adherens junction
    100385454
   04530 Tight junction
    100385454
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100385454
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100385454
   04670 Leukocyte transendothelial migration
    100385454
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100385454
   04919 Thyroid hormone signaling pathway
    100385454
  09159 Environmental adaptation
   04714 Thermogenesis
    100385454
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100385454
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100385454
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100385454
   05410 Hypertrophic cardiomyopathy (HCM)
    100385454
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100385454
   05414 Dilated cardiomyopathy (DCM)
    100385454
   05416 Viral myocarditis
    100385454
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100385454
   05100 Bacterial invasion of epithelial cells
    100385454
  09172 Infectious disease: viral
   05164 Influenza A
    100385454
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100385454
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100385454
   03036 Chromosome and associated proteins [BR:cjc03036]
    100385454
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100385454
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100385454
   04147 Exosome [BR:cjc04147]
    100385454
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100385454
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100385454
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100385454
    NuA4 complex
     100385454
  Chromatin remodeling factors
   BAF complex
    100385454
   PBAF complex
    100385454
   SWR1 complex
    100385454
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100385454
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100385454
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100385454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100385454
NCBI-ProteinID: XP_017828852
Position
6
AA seq 375 aa AA seqDB search
MMISLHLLSTTAPACARAGFAGDDAPRAVFPSIVGRPRHQGGVGGHGSEGLLRGRRGPEQ
ARGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHMVPIYEGYALPHAILHLDL
AGRDLTDYLMKILTECGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGDERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYTNTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaagggccggcttt
gcgggcgacgatgctccccgggccgtctttccctctatcgtggggcgccccaggcaccag
gggggggtggggggccatgggtccgaaggactcctacgtgggcgacgaggcccagagcaa
gcgcggggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaattgggat
gatatggagaaaatctggcaccacactttttacaatgagttgcgtgtggccccggaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgagagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgtggctatccaggccgtgctg
tccctctacgcctctgggcgcaccactggtattgtcatggactctggagacggggtaacc
cacatggtgcccatttacgagggctatgcccttccacacgctatcctgcatctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcacggagtgtggctacagcttc
accaccacggccgagcgggagatcgtacgcgacatcaaggagaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccacagctgcatcctcctcctctctggagaagagctat
gagctgcctgacggccaggtcatcaccattggtgacgagcggttccggtgtccggaggcg
ctgttccagccttcctttcttggcatggaatcttgtggcatccatgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtacaccaacactgtgctgtct
ggcggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcactgctctt
gcgcccagcaccatgaagatcaagatcattgcacccccagagcgtaagtactccgtgtgg
atcggcggctccatcctggcctcactgtccaccttccaacagatgtggattagcaagcag
gagtacgatgagtctggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388094Help
Entry
100388094         CDS       T03264                                 

Definition
(RefSeq) actin
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100388094
   04390 Hippo signaling pathway
    100388094
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100388094
  09143 Cell growth and death
   04210 Apoptosis
    100388094
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100388094
   04520 Adherens junction
    100388094
   04530 Tight junction
    100388094
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100388094
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100388094
   04670 Leukocyte transendothelial migration
    100388094
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100388094
   04919 Thyroid hormone signaling pathway
    100388094
  09159 Environmental adaptation
   04714 Thermogenesis
    100388094
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100388094
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100388094
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100388094
   05410 Hypertrophic cardiomyopathy (HCM)
    100388094
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100388094
   05414 Dilated cardiomyopathy (DCM)
    100388094
   05416 Viral myocarditis
    100388094
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100388094
   05100 Bacterial invasion of epithelial cells
    100388094
  09172 Infectious disease: viral
   05164 Influenza A
    100388094
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100388094
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100388094
   03036 Chromosome and associated proteins [BR:cjc03036]
    100388094
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100388094
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100388094
   04147 Exosome [BR:cjc04147]
    100388094
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100388094
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100388094
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100388094
    NuA4 complex
     100388094
  Chromatin remodeling factors
   BAF complex
    100388094
   PBAF complex
    100388094
   SWR1 complex
    100388094
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100388094
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100388094
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100388094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100388094
NCBI-ProteinID: XP_002763769
Position
17
AA seq 185 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAMFPSIVGRPRHQGVMVGMGQKDSYMGDEAQS
KHGILTLKYPIEHGIVTNWDDMEKIWQHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFQTFNTPAMYVAIQAVLSLYTSGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgctgcgctcgtcatcgacaatggttccggtatgtgcaaagctggc
tttgctggggatgacgccccccgagccatgtttccctccattgtcgggcgccctcggcac
cagggcgtgatggtcggcatgggccagaaggactcctacatgggcgacgaggcccagagc
aagcacggcatcctgaccctgaagtaccccattgagcacggcatcgtcaccaattgggat
gatatggagaaaatctggcagcacactttttacaatgagttgcgtgtggccccagaggag
caccctgtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagatcatgtttcagaccttcaacaccccagccatgtacgtggctatccaggctgtgctg
tccctctacacctctgggcgcaccactggtattgtcatggactctggagatggggtaacc
cacacggtgcccatttacgagggctatgcccttccacacgctatcctgcgtctggacctg
gctggccgggacctg

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396891Help
Entry
100396891         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 2-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100396891
   04390 Hippo signaling pathway
    100396891
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100396891
  09143 Cell growth and death
   04210 Apoptosis
    100396891
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100396891
   04520 Adherens junction
    100396891
   04530 Tight junction
    100396891
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100396891
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100396891
   04670 Leukocyte transendothelial migration
    100396891
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100396891
   04919 Thyroid hormone signaling pathway
    100396891
  09159 Environmental adaptation
   04714 Thermogenesis
    100396891
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100396891
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100396891
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100396891
   05410 Hypertrophic cardiomyopathy (HCM)
    100396891
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100396891
   05414 Dilated cardiomyopathy (DCM)
    100396891
   05416 Viral myocarditis
    100396891
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100396891
   05100 Bacterial invasion of epithelial cells
    100396891
  09172 Infectious disease: viral
   05164 Influenza A
    100396891
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100396891
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100396891
   03036 Chromosome and associated proteins [BR:cjc03036]
    100396891
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100396891
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100396891
   04147 Exosome [BR:cjc04147]
    100396891
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100396891
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100396891
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100396891
    NuA4 complex
     100396891
  Chromatin remodeling factors
   BAF complex
    100396891
   PBAF complex
    100396891
   SWR1 complex
    100396891
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100396891
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100396891
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100396891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100396891
NCBI-ProteinID: XP_002748261
Position
5
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWQHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFQTFNTPAMYVAIQAVLSLYTSGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTNYLMKILKEHGYSFTTMAEQEILRDIKEKLCYVALDFEQEMATASSSSSLEKSY
ELPDSQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSYMKCDVDIHKDLYANIVLS
GGTTMYPGITDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgctgcgctcgtcattgacaatggttctggcatgtgcaaagctggc
tttgctggggacgacgccccccgagccgtgtttccctccattgtcgggcgccctcggcac
cagggcgtgatggtcggcatgggccagaaggactcctatgtgggcgacgaggcccagagc
aagcgcggcatcctgaccctgaagtaccccattgagcacggcatcgtcaccaattgggat
gatatggagaaaatctggcagcacactttttacaatgagttgcgtgtggccccagaggag
caccctgtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagatcatgtttcagaccttcaacaccccagccatgtacgtggctatccaggctgtgctg
tccctctacacctctgggcgcaccactggtattgtcatggactctggagatggggtaacc
cacacggtgcccatttacgagggctatgcccttccacacgctatcctgcgtctggacctg
gctggccgggacctgaccaactacctcatgaagatcctcaaggagcacggctacagcttc
accaccatggccgagcaggagatcctacgcgacatcaaggagaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccacagcttcatcctcctcctctctggagaagagctat
gagctacctgacagccaggtcatcaccattggtaacgagcggttccggtgtccggaggct
ctgttccagccttcctttcttggcatggaatcttgtggcatccatgagaccaccttcaac
tcctatatgaagtgtgatgtggacatccacaaagacctgtacgccaacattgtgctgtct
ggcggcaccaccatgtacccaggcatcaccgacaggatgcagaaggagatcactgctctt
gcgcccagcaccatgaagatcaagatcattgcacccccagagcgtaagtactccgtgtgg
attggcggctccatcctggcctcactgtccaccttccaacagatgtggattagcaagcag
gagtacgatgagtctggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398645Help
Entry
100398645         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 2-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100398645
   04390 Hippo signaling pathway
    100398645
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100398645
  09143 Cell growth and death
   04210 Apoptosis
    100398645
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100398645
   04520 Adherens junction
    100398645
   04530 Tight junction
    100398645
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100398645
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100398645
   04670 Leukocyte transendothelial migration
    100398645
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100398645
   04919 Thyroid hormone signaling pathway
    100398645
  09159 Environmental adaptation
   04714 Thermogenesis
    100398645
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100398645
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100398645
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100398645
   05410 Hypertrophic cardiomyopathy (HCM)
    100398645
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100398645
   05414 Dilated cardiomyopathy (DCM)
    100398645
   05416 Viral myocarditis
    100398645
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100398645
   05100 Bacterial invasion of epithelial cells
    100398645
  09172 Infectious disease: viral
   05164 Influenza A
    100398645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100398645
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100398645
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398645
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100398645
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100398645
   04147 Exosome [BR:cjc04147]
    100398645
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100398645
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100398645
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100398645
    NuA4 complex
     100398645
  Chromatin remodeling factors
   BAF complex
    100398645
   PBAF complex
    100398645
   SWR1 complex
    100398645
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100398645
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100398645
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100398645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100398645
NCBI-ProteinID: XP_002757742
Ensembl: ENSCJAG00000023416
Position
14
AA seq 373 aa AA seqDB search
MEEEIDALVIDNGSGMCKAGFAGDDAPRAMFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYELRVALEEHPVLLTEAPRTPKANREMTQI
MFETFNTPAMYVAIQAVLSLYASGHTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAG
RNLTDYLMKILRERSYSFTTTAEREIVRDIKEKLCYVALDFKQEMATAASSSSLEKSYEL
PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGG
TTMYPGIADRMQKEITALVPSTMKIKIIAPPEHKYSVWIGGSILASLSTFQQMWISKQEY
DESGPSIVHRKCF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgatgcgctcgtcatcgacaatggttccggcatgtgcaaagctggc
tttgctggggacgacgccccccgagccatgtttccctccattgtcgggcgccctcggcac
cagggcgtgatggtcggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgcggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaattgggat
gatatggagaaaatctggcaccacactttttacgagttgcgtgtggccctggaggagcac
cccgtgctgctgaccgaggccccccgaacccctaaggccaacagagagatgactcagatc
atgtttgagaccttcaacaccccagccatgtatgtggctatccaggccgtgctgtccctc
tacgcctctgggcacaccactggtattgtcatggactctggagacggggtaacccacacg
gtgcccatttatgagggctatgcccttccacacgctatcctgcgtctggacctggctggc
cggaacctgaccgactacctcatgaagatcctcagggagcgcagctacagcttcaccacc
acggccgagcgggagatcgtacgtgacatcaaggagaagctgtgctatgtcgccctggac
ttcaagcaggagatggccacagctgcatcctcctcctctctggagaagagctatgagctg
cctgacggccaggtcatcaccattggtaacgagcggttccggtgtccggaggcgctgttc
cagccttcctttcttggcatggaatcttgtggcatccatgagaccaccttcaactccatc
atgaagtgtgatgtggacatccgcaaagacctgtacgccaacactgtgctgtctggcggc
accaccatgtacccaggcatcgccgacaggatgcagaaggagatcactgctcttgtgccc
agcaccatgaagatcaagatcattgcacccccagagcataagtactctgtgtggatcggc
ggctccatcctggcctcactgtccaccttccagcagatgtggattagcaagcaggagtac
gatgagtctggcccctctatcgtccaccgcaaatgcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404148Help
Entry
100404148         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 1-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100404148
   04390 Hippo signaling pathway
    100404148
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100404148
  09143 Cell growth and death
   04210 Apoptosis
    100404148
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404148
   04520 Adherens junction
    100404148
   04530 Tight junction
    100404148
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100404148
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404148
   04670 Leukocyte transendothelial migration
    100404148
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100404148
   04919 Thyroid hormone signaling pathway
    100404148
  09159 Environmental adaptation
   04714 Thermogenesis
    100404148
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100404148
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100404148
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100404148
   05410 Hypertrophic cardiomyopathy (HCM)
    100404148
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100404148
   05414 Dilated cardiomyopathy (DCM)
    100404148
   05416 Viral myocarditis
    100404148
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100404148
   05100 Bacterial invasion of epithelial cells
    100404148
  09172 Infectious disease: viral
   05164 Influenza A
    100404148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100404148
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100404148
   03036 Chromosome and associated proteins [BR:cjc03036]
    100404148
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100404148
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100404148
   04147 Exosome [BR:cjc04147]
    100404148
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100404148
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100404148
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100404148
    NuA4 complex
     100404148
  Chromatin remodeling factors
   BAF complex
    100404148
   PBAF complex
    100404148
   SWR1 complex
    100404148
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100404148
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100404148
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100404148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100404148
NCBI-ProteinID: XP_002763052
Position
X
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKPGFAGNDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILHLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIDNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALARSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaagcccggc
ttcgcgggcaacgatgctccccgggccgtcttcccctctatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggactcctacgtgggtgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcatggcattgtcaccaactgggac
gacatggagaagatctggcaccacactttttacaacgagctgcgtgtggctcctgaggag
caccccgtgctgcttactgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtatgtggccatccaggctgtgctt
tccttgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggagtcacc
cacactgtgcccatctatgaggggtatgccctcccccacgccatcctacatctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacagctgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggcggcctccagctcctccctggagaagagctat
gagctgcccgatggtcaggtcatcaccatcgacaacgagcggttccgctgccctgaggca
ctcttccagccttctttcctgggcatggaatcttgtggcatccacgaaactacctttaac
tccatcatgaaatgtgacgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggtggtaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgccctg
gcacgcagcacaatgaagatcaagatcattgctcctcccgagcgcaagtactcagtgtgg
attggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404409Help
Entry
100404409         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 1-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100404409
   04390 Hippo signaling pathway
    100404409
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100404409
  09143 Cell growth and death
   04210 Apoptosis
    100404409
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404409
   04520 Adherens junction
    100404409
   04530 Tight junction
    100404409
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100404409
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404409
   04670 Leukocyte transendothelial migration
    100404409
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100404409
   04919 Thyroid hormone signaling pathway
    100404409
  09159 Environmental adaptation
   04714 Thermogenesis
    100404409
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100404409
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100404409
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100404409
   05410 Hypertrophic cardiomyopathy (HCM)
    100404409
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100404409
   05414 Dilated cardiomyopathy (DCM)
    100404409
   05416 Viral myocarditis
    100404409
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100404409
   05100 Bacterial invasion of epithelial cells
    100404409
  09172 Infectious disease: viral
   05164 Influenza A
    100404409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100404409
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100404409
   03036 Chromosome and associated proteins [BR:cjc03036]
    100404409
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100404409
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100404409
   04147 Exosome [BR:cjc04147]
    100404409
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100404409
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100404409
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100404409
    NuA4 complex
     100404409
  Chromatin remodeling factors
   BAF complex
    100404409
   PBAF complex
    100404409
   SWR1 complex
    100404409
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100404409
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100404409
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100404409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100404409
NCBI-ProteinID: XP_002749016
Position
5
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAVPHAILHLDL
AGRDLTDYLMKILTERGYSFTTTAEREILRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITAPAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHHKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgctccccgggccgtcttcccctctatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggactcctacgtgggtgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcatggcattgtcaccaactgggac
gacatggagaagatctggcaccacactttttacaacgagctgcgtgtggctcctgaggag
caccccgtgctgcttactgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtatgtggccatccaggctgtgctt
tccttgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctatgaggggtatgccgtcccccacgccatcctacatctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacagctgagcgggaaatcctgcgtgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggcggcctccagctcctccctggagaagagctat
gagctgcccgatggtcaggtcatcaccatcggcaacgagcggttccgctgccctgaggca
ctcttccagccttctttcctgggcatggaatcttgtggcatccacgaaactacctttaac
tccatcatgaaatgtgacgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggtggtaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgccccg
gcacccagcacaatgaagatcaagatcattgctcctcccgagcgcaagtactcagtgtgg
attggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtccggcccctccatcgtccaccacaaatgcttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406284Help
Entry
100406284         CDS       T03264                                 

Definition
(RefSeq) actin-1
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100406284
   04390 Hippo signaling pathway
    100406284
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100406284
  09143 Cell growth and death
   04210 Apoptosis
    100406284
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100406284
   04520 Adherens junction
    100406284
   04530 Tight junction
    100406284
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100406284
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100406284
   04670 Leukocyte transendothelial migration
    100406284
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100406284
   04919 Thyroid hormone signaling pathway
    100406284
  09159 Environmental adaptation
   04714 Thermogenesis
    100406284
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100406284
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100406284
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406284
   05410 Hypertrophic cardiomyopathy (HCM)
    100406284
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100406284
   05414 Dilated cardiomyopathy (DCM)
    100406284
   05416 Viral myocarditis
    100406284
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100406284
   05100 Bacterial invasion of epithelial cells
    100406284
  09172 Infectious disease: viral
   05164 Influenza A
    100406284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100406284
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100406284
   03036 Chromosome and associated proteins [BR:cjc03036]
    100406284
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100406284
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100406284
   04147 Exosome [BR:cjc04147]
    100406284
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100406284
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100406284
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100406284
    NuA4 complex
     100406284
  Chromatin remodeling factors
   BAF complex
    100406284
   PBAF complex
    100406284
   SWR1 complex
    100406284
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100406284
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100406284
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100406284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100406284
NCBI-ProteinID: XP_017828046
Position
1
AA seq 109 aa AA seqDB search
MEEEIAALVIDNGSGTCKAGFAGDDAPQAVFPSIVGRPRHQGMMVGMGQKDSYMGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEKHPVLLTEAP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgctgctctcgtcatcgacaatggttccggcacatgcaaagctggc
tttgctggggacgacgctccccaagctgtgttcccctccattgtcgggcgccctcggcac
cagggcatgatggtcggcatgggccagaaggactcctacatgggcgatgaggcccagagc
aagcgtggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaattgggat
gacatggagaaaatctggcaccacactttttacaacgagctgcgtgtggccccggagaag
caccccgtgctgctgaccgaggccccctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406296Help
Entry
100406296         CDS       T03264                                 

Gene name
ACTB
Definition
(RefSeq) actin beta
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100406296 (ACTB)
   04390 Hippo signaling pathway
    100406296 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100406296 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    100406296 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100406296 (ACTB)
   04520 Adherens junction
    100406296 (ACTB)
   04530 Tight junction
    100406296 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100406296 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100406296 (ACTB)
   04670 Leukocyte transendothelial migration
    100406296 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100406296 (ACTB)
   04919 Thyroid hormone signaling pathway
    100406296 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100406296 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100406296 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100406296 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406296 (ACTB)
   05410 Hypertrophic cardiomyopathy (HCM)
    100406296 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100406296 (ACTB)
   05414 Dilated cardiomyopathy (DCM)
    100406296 (ACTB)
   05416 Viral myocarditis
    100406296 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100406296 (ACTB)
   05100 Bacterial invasion of epithelial cells
    100406296 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    100406296 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100406296 (ACTB)
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100406296 (ACTB)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100406296 (ACTB)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100406296 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100406296 (ACTB)
   04147 Exosome [BR:cjc04147]
    100406296 (ACTB)
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100406296 (ACTB)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100406296 (ACTB)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100406296 (ACTB)
    NuA4 complex
     100406296 (ACTB)
  Chromatin remodeling factors
   BAF complex
    100406296 (ACTB)
   PBAF complex
    100406296 (ACTB)
   SWR1 complex
    100406296 (ACTB)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100406296 (ACTB)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100406296 (ACTB)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100406296 (ACTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100406296
NCBI-ProteinID: XP_008981959
Ensembl: ENSCJAG00000000008
Position
2
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaaggccggc
tttgcgggcgacgatgctccccgggccgtcttcccctctatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggactcctacgtgggtgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcatggcattgtcaccaactgggac
gacatggagaagatctggcaccacactttttacaacgagctgcgtgtggctcctgaggag
caccccgtgctgcttactgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtatgtggccatccaggctgtgctt
tccttgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctatgaggggtatgccctcccccacgccatcctacgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacagctgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggcggcctccagctcctccctggagaagagctat
gagctgcccgatggtcaggtcatcaccatcggcaacgagcggttccgctgccctgaggca
ctcttccagccttctttcctgggcatggaatcttgtggcatccacgaaactacctttaac
tccatcatgaaatgtgacgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggtggtaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgccctg
gcacccagcacaatgaagatcaagatcattgctcctcccgagcgcaagtactcagtgtgg
attggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406907Help
Entry
100406907         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 2-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100406907
   04390 Hippo signaling pathway
    100406907
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100406907
  09143 Cell growth and death
   04210 Apoptosis
    100406907
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100406907
   04520 Adherens junction
    100406907
   04530 Tight junction
    100406907
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100406907
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100406907
   04670 Leukocyte transendothelial migration
    100406907
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100406907
   04919 Thyroid hormone signaling pathway
    100406907
  09159 Environmental adaptation
   04714 Thermogenesis
    100406907
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100406907
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100406907
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406907
   05410 Hypertrophic cardiomyopathy (HCM)
    100406907
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100406907
   05414 Dilated cardiomyopathy (DCM)
    100406907
   05416 Viral myocarditis
    100406907
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100406907
   05100 Bacterial invasion of epithelial cells
    100406907
  09172 Infectious disease: viral
   05164 Influenza A
    100406907
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100406907
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100406907
   03036 Chromosome and associated proteins [BR:cjc03036]
    100406907
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100406907
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100406907
   04147 Exosome [BR:cjc04147]
    100406907
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100406907
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100406907
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100406907
    NuA4 complex
     100406907
  Chromatin remodeling factors
   BAF complex
    100406907
   PBAF complex
    100406907
   SWR1 complex
    100406907
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100406907
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100406907
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100406907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100406907
NCBI-ProteinID: XP_017821891
Ensembl: ENSCJAG00000022038
Position
18
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIIRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSMWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgctgcgctcgtcatcgacaatggttccggcatgtgcaaagctggc
tttgctggggacgacgccccccgagccgtgtttccctccattgtcgggcgccctcggcac
cagggcgtgatggtcggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgcggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaactgggat
gatatggagaaaatctggcaccacactttttacaatgagttgcgtgtggccccggaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagatcatgtttgagaccttcaacaccccagccatgtacgtggctatccaggccgtgctg
tccctctacgcctctgggcgcaccactggtattgtcatggactctggagacggggtaacc
cacacggtgcccatttatgagggctatgcccttccacacgctatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc
accaccacggccgagcgggagatcatacgcgacatcaaggagaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccacagctgcatcctcctcctctctggagaagagctat
gagctgcctgacggccaggtcatcaccattggtaacgagcggttccggtgtccggaggcg
ctgttccagccttcttttcttggcatggaatcttgtggcatccatgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtacgccaacactgtgctgtct
ggcggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcactgctctt
gcgcccagcaccatgaagatcaagatcattgcacccccagagcgtaagtactccatgtgg
atcggcggctccatcctggcctcactgtccaccttccaacagatgtggattagcaagcag
gagtacgatgagtctggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409006Help
Entry
100409006         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100409006
   04390 Hippo signaling pathway
    100409006
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100409006
  09143 Cell growth and death
   04210 Apoptosis
    100409006
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100409006
   04520 Adherens junction
    100409006
   04530 Tight junction
    100409006
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100409006
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100409006
   04670 Leukocyte transendothelial migration
    100409006
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100409006
   04919 Thyroid hormone signaling pathway
    100409006
  09159 Environmental adaptation
   04714 Thermogenesis
    100409006
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100409006
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100409006
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100409006
   05410 Hypertrophic cardiomyopathy (HCM)
    100409006
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100409006
   05414 Dilated cardiomyopathy (DCM)
    100409006
   05416 Viral myocarditis
    100409006
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100409006
   05100 Bacterial invasion of epithelial cells
    100409006
  09172 Infectious disease: viral
   05164 Influenza A
    100409006
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100409006
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100409006
   03036 Chromosome and associated proteins [BR:cjc03036]
    100409006
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100409006
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100409006
   04147 Exosome [BR:cjc04147]
    100409006
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100409006
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100409006
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100409006
    NuA4 complex
     100409006
  Chromatin remodeling factors
   BAF complex
    100409006
   PBAF complex
    100409006
   SWR1 complex
    100409006
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100409006
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100409006
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100409006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100409006
NCBI-ProteinID: XP_008987529
Ensembl: ENSCJAG00000002885
UniProt: F7I0W8
Position
X
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgctgcgctcgtcatcgacaatggttccggcatgtgcaaagctggc
tttgctggggacgacgccccccgagccgtgtttccctccattgtcgggcgccctcggcac
cagggcgtgatggtcggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgcggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaattgggat
gatatggagaaaatctggcaccacactttttacaatgagttgcgtgtggccccggaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagatcatgtttgagaccttcaacaccccagccatgtacgtggctatccaggccgtgctg
tccctctacgcctctgggcgcaccactggtattgtcatggactctggagacggggtaacc
cacacggtgcccatttatgagggctatgcccttccacacgctatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc
accaccacggccgagcgggagatcgtacgcgacatcaaggagaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccacagctgcatcctcctcctctctggagaagagctat
gagctgcctgacggccaggtcatcaccattggtaacgagcggttccggtgtccggaggcg
ctgttccagccttcttttcttggcatggaatcttgtggcatccatgagaccaccttcaac
tccatcatgaagtgtgatgtggacatccgcaaagacctgtacgccaacactgtgctgtct
ggcggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcactgctctt
gcgcccagcaccatgaagatcaagatcattgcacccccagagcgtaagtactccgtgtgg
atcggcggctccatcctggcctcactgtccaccttccaacagatgtggattagcaagcag
gagtacgatgagtctggtccctccatcgtccaccgcaaatgcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410882Help
Entry
100410882         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 2-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100410882
   04390 Hippo signaling pathway
    100410882
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100410882
  09143 Cell growth and death
   04210 Apoptosis
    100410882
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100410882
   04520 Adherens junction
    100410882
   04530 Tight junction
    100410882
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100410882
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100410882
   04670 Leukocyte transendothelial migration
    100410882
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100410882
   04919 Thyroid hormone signaling pathway
    100410882
  09159 Environmental adaptation
   04714 Thermogenesis
    100410882
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100410882
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100410882
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100410882
   05410 Hypertrophic cardiomyopathy (HCM)
    100410882
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100410882
   05414 Dilated cardiomyopathy (DCM)
    100410882
   05416 Viral myocarditis
    100410882
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100410882
   05100 Bacterial invasion of epithelial cells
    100410882
  09172 Infectious disease: viral
   05164 Influenza A
    100410882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100410882
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100410882
   03036 Chromosome and associated proteins [BR:cjc03036]
    100410882
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100410882
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100410882
   04147 Exosome [BR:cjc04147]
    100410882
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100410882
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100410882
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100410882
    NuA4 complex
     100410882
  Chromatin remodeling factors
   BAF complex
    100410882
   PBAF complex
    100410882
   SWR1 complex
    100410882
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100410882
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100410882
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100410882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100410882
NCBI-ProteinID: XP_002758560
Ensembl: ENSCJAG00000022821
Position
15
AA seq 374 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANKEKMTQ
IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILHLDLA
GRDLTDYLMKILTERGYSFTTTAKREIVRDIKEKLCYVALDFKQEMATAASSSSLEKSYE
LPDGQVITIGNEQFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPEHKYSVWIGGSILASLSTFQQMWISKQE
YDESGPSIVHRKCF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgctgcgctcgtcatcgacaatggttccggcatgtgcaaagctggc
tttgctggggacgacgccccccgagccgtgtttccctccattgtcgggcgccctcggcac
cagggcgtgatggtcggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgcggcatcctgaccctgaagtaccccatcgagcacatcgtcaccaattgggatgat
atggagaaaatctggcaccacactttttacaatgagttgcgtgtggccccggaggagcac
cccgtgttgctgaccgaggcccccctgaaccccaaggccaacaaagagaagatgactcag
atcatgtttgagaccttcaacaccccagccatgtacgtggctatccaggccgtgctgtcc
ctctatgcctctgggcgcaccactggtattgtcatggactctggagatggggtaacccac
acggtgcccatttacgagggctatgcccttccacatgctatcctgcatctggacctggct
ggccgggacctgaccgactacctcatgaagatcctcacggaacgcggctacagcttcacc
accacggccaagcgggagatcgtacgcgacatcaaggagaagctgtgctatgttgccctg
gacttcaagcaggagatggccacagctgcatcctcctcctctctggagaagagctatgag
ctgcctgacggccaggtcatcaccattggtaacgagcagttccggtgtccggaggcgctg
ttccagccttcctttcttggcatggaatcttgtggcatccatgagaccaccttcaactcc
atcatgaagtgtgacgtggacatccgcaaagacctgtacgccaacactgtgctgtctggc
ggcaccactatgtacccaggcatcgccgacaggatgcagaaggagatcactgctcttgcg
cccagcaccatgaagatcaagatcattgcacccccagagcataagtactccgtgtggatc
ggcggctccatcctggcctcactgtccaccttccaacagatgtggattagcaagcaggag
tacgatgagtctggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412618Help
Entry
100412618         CDS       T03264                                 

Definition
(RefSeq) actin, cytoplasmic 1-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100412618
   04390 Hippo signaling pathway
    100412618
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100412618
  09143 Cell growth and death
   04210 Apoptosis
    100412618
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100412618
   04520 Adherens junction
    100412618
   04530 Tight junction
    100412618
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100412618
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100412618
   04670 Leukocyte transendothelial migration
    100412618
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100412618
   04919 Thyroid hormone signaling pathway
    100412618
  09159 Environmental adaptation
   04714 Thermogenesis
    100412618
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100412618
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100412618
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100412618
   05410 Hypertrophic cardiomyopathy (HCM)
    100412618
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100412618
   05414 Dilated cardiomyopathy (DCM)
    100412618
   05416 Viral myocarditis
    100412618
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100412618
   05100 Bacterial invasion of epithelial cells
    100412618
  09172 Infectious disease: viral
   05164 Influenza A
    100412618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100412618
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100412618
   03036 Chromosome and associated proteins [BR:cjc03036]
    100412618
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100412618
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100412618
   04147 Exosome [BR:cjc04147]
    100412618
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100412618
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100412618
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100412618
    NuA4 complex
     100412618
  Chromatin remodeling factors
   BAF complex
    100412618
   PBAF complex
    100412618
   SWR1 complex
    100412618
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100412618
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100412618
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100412618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100412618
NCBI-ProteinID: XP_002751826
Position
8
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGITMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgctccccgggccgtcttcccctctatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggactcctacgtgggtgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcatggcattgtcaccaactgggac
gacatggagaagatctggcaccacactttttacaacgagctgcgtgtggctcctgaggag
caccccgtgctgcttactgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtatgtggccatccaggctgtgctt
tccttgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctatgaggggtatgccctcccccacgccatcctacgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacagctgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggcggcctccagctcctccctggagaagagctat
gagctgcctgatggtcaggtcatcaccatcggcaacgagcggttccgctgccctgaggca
ctcttccagccttctttcctgggcatggaatcttgtggcatccacgaaactacctttaac
tccatcatgaaatgtgacgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggtggtatcaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgccctg
gcacccagcacaatgaagatcaagatcattgctcctcccgagcgcaagtactcagtgtgg
attggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100895380Help
Entry
100895380         CDS       T03264                                 

Definition
(RefSeq) actin-1-like
  KO
K05692  actin beta/gamma 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04210  Apoptosis
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05164  Influenza A
cjc05205  Proteoglycans in cancer
cjc05225  Hepatocellular carcinoma
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100895380
   04390 Hippo signaling pathway
    100895380
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100895380
  09143 Cell growth and death
   04210 Apoptosis
    100895380
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100895380
   04520 Adherens junction
    100895380
   04530 Tight junction
    100895380
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100895380
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100895380
   04670 Leukocyte transendothelial migration
    100895380
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100895380
   04919 Thyroid hormone signaling pathway
    100895380
  09159 Environmental adaptation
   04714 Thermogenesis
    100895380
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100895380
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100895380
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100895380
   05410 Hypertrophic cardiomyopathy (HCM)
    100895380
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100895380
   05414 Dilated cardiomyopathy (DCM)
    100895380
   05416 Viral myocarditis
    100895380
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100895380
   05100 Bacterial invasion of epithelial cells
    100895380
  09172 Infectious disease: viral
   05164 Influenza A
    100895380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100895380
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100895380
   03036 Chromosome and associated proteins [BR:cjc03036]
    100895380
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100895380
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100895380
   04147 Exosome [BR:cjc04147]
    100895380
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100895380
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100895380
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100895380
    NuA4 complex
     100895380
  Chromatin remodeling factors
   BAF complex
    100895380
   PBAF complex
    100895380
   SWR1 complex
    100895380
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100895380
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100895380
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100895380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100895380
NCBI-ProteinID: XP_008996445
Position
5
AA seq 119 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFSRAAWASEHPVLLTEAPDPQANREKMTQI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgctccccgggccgtcttcccctctatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggactcctacgtgggtgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcatggcattgtcaccaactgggac
gacatggagaagatctggcaccacactttttctcgagctgcgtgggcctcggagcacccc
gtgctgcttactgaggcccccgacccccaggccaaccgtgagaagatgacccagatc

DBGET integrated database retrieval system