KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385492Help
Entry
100385492         CDS       T03264                                 

Gene name
SIPA1
Definition
(RefSeq) signal-induced proliferation-associated 1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100385492 (SIPA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100385492 (SIPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rap_GAP PDZ PDZ_6 MscS_porin ATG16 ZapB PI3K_P85_iSH2 CENP-F_N DUF812 DUF4472 Trimer_CC YabA APG6_N Lzipper-MIP1 ERM bZIP_2
Motif
Other DBs
NCBI-GeneID: 100385492
NCBI-ProteinID: XP_002755580
Ensembl: ENSCJAG00000002062
UniProt: F6VSA4
Position
11
AA seq 1042 aa AA seqDB search
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPLRGPLLRSGSDAGEA
KPPTPASPRARAHSHEEASHPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGTGSHSEASSGTLASAEDQAASSDLLLGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPLRGLSPRKLLEHVA
PRLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGNVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRT
QDTPAFGPALPAGGGPFVANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRAPGAELQAAGSLVWGVRAAPGARVASGAQAG
GPEGAEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPREGQGRLGFEVDDEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYMLSLQ
EPSRRGVPEPVQDEAEGVTLLPTTRQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSTDSETPLTQDGPGSPSGSEDKGNPAPELRS
SFLPRTLSLRNSISRIMSEAGSETLEDEWQSISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPESGSLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHSNQRLQAES
ESAATRLLLASKQLGSPTADLA
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgtgggccggcggtgtggggagccctcggcggggaatggcccctgcatccacg
gatgacctctttgcacgcaagctgcgccagccggcacggcccccgctgacacctcacacc
tttgagccgaggccactccggggccccctcctgcgcagcggcagcgatgcaggcgaggcc
aagccccccacgcctgccagcccccgtgcccgtgcccacagccacgaagaggccagccac
cctgctgccacttccacccggcttttcactgacccgctggcactgctggggctgccagca
gaggaaccagagcctgccttcccgccagtgcttgagcctcgatggtttgcccactatgac
gtgcaaagcttgctctttgattgggctccgaggtctcagggaacggggagccactcggag
gccagctctgggaccctggcttcagccgaggaccaggctgccagctcggacctgctgctt
ggggcacctggctttgtgtgtgagctcgggggtgagggtgagttaggcctgggtggacca
gcatccccacctgtgccccctgcactgcccaatgcggctgtctccatcctggaggagcca
cagaaccgaacctcagcctacagcctggagcacgcagacctgggtgctggctactaccgc
aagtacttctatggcaaagaacaccagaacttcttcgggatggacgagtcgctgggcccg
gtggcagtgagcctgcggcgggaggaaaaggagggcagcggagggggcaccctgcacagc
taccgcgtcatcgtacggaccacgcagctccggaccctccgtggcaccatctcggaggat
gcgctgccgccggggcccctacggggtctgtccccgaggaaacttcttgagcacgtggcg
ccgcggttgagccccagttgcctgcgcctgggctcagcttcacccaaggtaccacgaacg
ctgcttacactggatgagcaagtgctcagcttccagcgcaaggtgggcatcctctactgc
cgggcaggccagggctcggaggaagagatgtacaacaaccaggaggcgggaccggccttc
atgcagttcctcaccttgctgggcaatgtggtgcggctcaaaggctttgagagttaccgg
gcccagctggacaccaaaacggattccacaggcacgcactccctctacaccacgtaccag
gaccacgagatcatgttccacgtgtccacaatgctgccttacacccctaataaccagcag
cagctcctgcggaagcgccacatcggcaacgacattgtgaccatcgtgttccaggagcct
ggcagcaagcccttctgccccaccaccatccgctcacacttccaacatgtgttcctagtg
gtgcgggcacacgcaccctgcaccccccacacctcctacagggtggccgtgagccgcacc
caggacaccccggccttcggaccagctctgcccgctggcggaggcccctttgtggccaac
gccgacttccgggccttcctgctggccaaggcgctgaatggcgaacaggccgccggccac
gcgcgccagttccacgccatggccacgcgcacccgccagcagtacctgcaggacctggcc
accaacgaggtgaccactacgtcgctggactcggcttcacgcttcggcctgccctccctg
ggtgggaggcgccgagcggcccctcgggccccgggcgccgagctgcaggcagcgggctca
ctggtgtggggcgtgcgcgcggcgcccggggcgcgggtcgcctccggggctcaggcgggc
ggccccgaaggcgccgaggtgccctgcttgctgggcatctcggccgaagctctggtgctg
gtggctccgcgcgacggccgcgtagtgttcaactgcgcctgtcgcgacgtgctggcctgg
accttctccgagcagcagctggacctgtaccacggccgcggggaggcgatcacgctgcgc
ttcgatgggtcccccggccaagccgtgggcgaggtggtggcgcgcctgcagctggtgagc
cgtggctgcgagacccgcgagctggcgctgccccgcgaaggtcaaggccgcttgggcttc
gaggtggacgacgagggcttcgtcacgcatgtggagcgcttcacgttcgcggagacggct
gggctgcggcccggggcgcgcctgctgcgggtgtgcggccagacgctgcccagcctccgg
ccagaggccgctgcccagctactgcgctccgcgcccaaggtctgcgtcaccgtcctgccc
cccgacgagagcggccggccccgcaggagtttttcggagctgtacatgctgtctctgcag
gagcccagccggcggggggtcccagagcctgtgcaggatgaggccgaaggggtgaccctg
ctgcccaccacaaggcagctgctgcacctgtgcctacaagatggcggcagccccccaggg
cctggggatctggcagaggagaggactgagttcctgcacagccagaactcgctgtcacca
cgcagctccctgtcagatgaggccccagtcctgcccaacaccaccccggacctcctcctg
gccaccacggccaagccatcagtacccagcactgacagtgagacacctctgacccaggat
gggccaggcagtcccagtggctctgaggacaaggggaacccagccccagagctgaggtcc
tcctttctgccacgtaccttgtctctgcggaactccattagcaggatcatgtcagaggca
ggcagtgagaccctggaggacgagtggcagtccatctcggagatcgcctccacttgcaac
accatcctggagtcgctgtcccgagagggacagcccatcccagagagcggagaccctaag
ggaactccaaagtctgatgctgagccagagtctgggagcctctcagagaaggtctctcac
ttggagtccatgctcaggaagctgcaggaggacctgcagaaggaaaaggcagacagggca
gccctggaggaggaggtacggagcctgagacacagcaaccagaggctgcaggcggagtct
gagagcgcagccacgcgcctgcttctggcctccaagcagctgggctcacccactgccgac
ctggcctga

DBGET integrated database retrieval system