KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385528Help
Entry
100385528         CDS       T03264                                 

Gene name
SERPINE1
Definition
(RefSeq) serpin family E member 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04066  HIF-1 signaling pathway
cjc04115  p53 signaling pathway
cjc04218  Cellular senescence
cjc04371  Apelin signaling pathway
cjc04390  Hippo signaling pathway
cjc04610  Complement and coagulation cascades
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05142  Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100385528 (SERPINE1)
   04371 Apelin signaling pathway
    100385528 (SERPINE1)
   04066 HIF-1 signaling pathway
    100385528 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100385528 (SERPINE1)
   04218 Cellular senescence
    100385528 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100385528 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100385528 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100385528 (SERPINE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100385528 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100385528 (SERPINE1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100385528 (SERPINE1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   100385528 (SERPINE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 100385528
NCBI-ProteinID: XP_002744016
Ensembl: ENSCJAG00000015954
UniProt: F7I5C2
Position
2
AA seq 402 aa AA seqDB search
MQTSPALACLVLGLALLFGEGSTVHHPPSHVAHLASDFGVRVFQQVSQASKDRNVVFSPY
GVASVLAMLQSTTGGETRRQIQAAMGFKIDDKGTAPALRHLYKELMGPWNKDEISTTDAI
FVQRDLKLVPGFMPHFFRLFRTTVKQVDFAEVERARFIINDWVKTHTKGMIGDLLGKGAV
DQLTRLVLVNALYFNGHWKTPFPDSGTHHRLFHKSDGSTVSVPMMSQTNKFNYTEFTTPD
GHYYDILELPYHGTTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPK
FSLETEVDLRKPLENLGMTNVFRPFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASS
STAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgtctccagctctcgcctgcctggtcctgggcctggccctcctctttggtgaa
gggtccaccgttcaccatcccccatcccacgtggcccacctggcctcagacttcggggtg
agggtgtttcagcaggtgtcgcaggcctccaaggaccgcaacgtggttttctcaccctat
ggggtggcctcggtgttggccatgctgcagtcgaccacgggaggagaaacccggaggcag
atccaagcggccatgggattcaagattgatgacaagggcacggcccctgccctccggcat
ttgtacaaggagctgatggggccgtggaacaaggatgagatcagcaccacagacgccatc
ttcgtccagcgggacctgaagctggtcccgggcttcatgcctcacttcttcaggctcttc
cggaccacggttaagcaggtggactttgcagaggtggagagagccagattcatcatcaat
gactgggtgaagacacacacaaaaggtatgatcggcgacttgcttgggaaaggggctgtg
gaccagctgacgcggctggtgctggtgaacgccctctacttcaatggccactggaagact
cccttcccagactccggcacccaccaccgtctcttccacaagtcagacggcagcactgtc
tccgtgcccatgatgagtcagaccaacaagttcaactatactgagttcaccacacccgat
ggccattactacgacatcctggagctgccctaccacgggaccaccctcagcatgttcatt
gctgctccttatgaaaaagaggtgcctctctctgccctcaccaacattctgagtgcccag
ctcatcagccactggaaaggcaacatgaccaggctgccccgcctcctcgttctgcccaag
ttctccctggagacggaagtcgacctcaggaagcccctagagaacttgggaatgaccaac
gtattcagaccattccaggcggactttacaagtctttcagaccaagaacctctccacgtc
gcgcaggcgctgcagaaagtgaagatcgaggtgaacgagagcggcacggtggcctcctca
tccacagctgtcatagtctcagcccgaatggcccccgaggagatcatcatggacagaccc
ttcctctttgtggtccggcacaaccccacaggaacagtccttttcatgggccaagtcatg
gaaccctga

DBGET integrated database retrieval system