KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385618Help
Entry
100385618         CDS       T03264                                 

Gene name
CASP1
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100385618 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100385618 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    100385618 (CASP1)
   04625 C-type lectin receptor signaling pathway
    100385618 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100385618 (CASP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100385618 (CASP1)
   05133 Pertussis
    100385618 (CASP1)
   05134 Legionellosis
    100385618 (CASP1)
  09172 Infectious disease: viral
   05164 Influenza A
    100385618 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100385618 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100385618 (CASP1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100385618 (CASP1)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C14: caspase family
   100385618 (CASP1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100385618 (CASP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD Cdh1_DBD_1
Motif
Other DBs
NCBI-GeneID: 100385618
NCBI-ProteinID: XP_009004947
Ensembl: ENSCJAG00000009842
Position
11
AA seq 389 aa AA seqDB search
MADKILKEKRRLFIRSVGEGTINGLLDELLEKGVLNEEEIEKVKRENATVMDKARALLDS
VIRKGARACQVCITYICEEDRHLAEKLGLSADSQEALPSFPAPPAVQNKPLMRSEGNVKL
CPPGEAERIKKEQSAEIYPTMDKSSRTRLALIICNEEFDSLSRRTGAEVDITGMEILLKN
LGYSVDVRKNLTASEMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKYSEQVPDI
LRVNEIFRNLNTRNCPSLKDKPKVIIIQACRGENEGVVWLKDSAGVSENTSLPTTEAFED
DAIGKAHIEKDFIAFCSSTPDNVSWRHPTKGSVFIMRLIEHLQEYACSCDVEEIFRKVRL
SFERTDGRVQMPTAERVTLTRRFYLFPGC
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaagatcctgaaggagaagaggaggctctttatccgttcagtgggtgaaggt
acaataaatggcttactggatgaattactagagaaaggggtgctgaacgaggaagagatt
gagaaagtaaaacgtgaaaatgccacagtcatggataaggcccgagctttgcttgactct
gttattcggaagggggctcgggcatgccaagtttgcatcacgtacatttgtgaagaggat
cgtcacctggcagagaagctgggcctctcagcagattctcaagaagcacttccgtccttc
ccagctcctccggcagtgcagaacaagccactgatgcgctcagaagggaatgtcaagctt
tgccccccaggagaagctgaaaggataaagaaggaacagtcggcagagatttatccaaca
atggacaagtcaagccgcacacgtcttgctctcattatctgcaatgaagaatttgacagt
ctttctagaagaactggagctgaggttgacatcacaggcatggaaatactgctaaaaaat
ctggggtacagtgtggatgtgagaaaaaatctcactgcttcagaaatgactacagagctg
gaggcgtttgcacaccgcccagagcacaagacctctgatagcacgttcctggtgttcatg
tctcatggtattcgggaaggcatttgtgggaagaaatactctgagcaagtccccgatata
ttacgagtcaatgaaatctttagaaatttgaataccaggaactgcccaagtttgaaggac
aaacccaaggtgatcatcatccaggcctgtcgtggtgagaacgaaggtgtggtgtggtta
aaagactcagcaggagtctctgaaaacacatctttaccaactacagaagcttttgaagat
gatgccattgggaaagcccacatagagaaggattttattgctttctgctcttccacacca
gataatgtttcttggagacatcccacaaagggctctgtttttattatgagactcattgaa
catttgcaagaatatgcctgttcctgtgatgtggaggaaattttccgcaaggttcgactt
tcatttgagcgaacagatggtagagtgcagatgcccaccgctgaaagggtgactttgaca
agacgtttctacctcttcccaggatgttaa

DBGET integrated database retrieval system