KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385658Help
Entry
100385658         CDS       T03264                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100385658 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100385658 (ADCY2)
   04371 Apelin signaling pathway
    100385658 (ADCY2)
   04020 Calcium signaling pathway
    100385658 (ADCY2)
   04072 Phospholipase D signaling pathway
    100385658 (ADCY2)
   04024 cAMP signaling pathway
    100385658 (ADCY2)
   04022 cGMP-PKG signaling pathway
    100385658 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100385658 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100385658 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100385658 (ADCY2)
   04062 Chemokine signaling pathway
    100385658 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    100385658 (ADCY2)
   04922 Glucagon signaling pathway
    100385658 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    100385658 (ADCY2)
   04912 GnRH signaling pathway
    100385658 (ADCY2)
   04913 Ovarian steroidogenesis
    100385658 (ADCY2)
   04915 Estrogen signaling pathway
    100385658 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    100385658 (ADCY2)
   04921 Oxytocin signaling pathway
    100385658 (ADCY2)
   04926 Relaxin signaling pathway
    100385658 (ADCY2)
   04918 Thyroid hormone synthesis
    100385658 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    100385658 (ADCY2)
   04916 Melanogenesis
    100385658 (ADCY2)
   04925 Aldosterone synthesis and secretion
    100385658 (ADCY2)
   04927 Cortisol synthesis and secretion
    100385658 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100385658 (ADCY2)
   04270 Vascular smooth muscle contraction
    100385658 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    100385658 (ADCY2)
   04971 Gastric acid secretion
    100385658 (ADCY2)
   04972 Pancreatic secretion
    100385658 (ADCY2)
   04976 Bile secretion
    100385658 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100385658 (ADCY2)
   04727 GABAergic synapse
    100385658 (ADCY2)
   04725 Cholinergic synapse
    100385658 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    100385658 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100385658 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    100385658 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    100385658 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100385658 (ADCY2)
   04714 Thermogenesis
    100385658 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100385658 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    100385658 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100385658 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100385658 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100385658 (ADCY2)
   05163 Human cytomegalovirus infection
    100385658 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100385658 (ADCY2)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100385658 (ADCY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Motif
Other DBs
NCBI-GeneID: 100385658
NCBI-ProteinID: XP_002745178
Ensembl: ENSCJAG00000008816
Position
2
AA seq 1091 aa AA seqDB search
MWQEAMRRRRYLRDRAEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLFIVMGACLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGDTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGTAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSDSEETIPPTANTSNTSFS
ASNNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNSILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHA
QEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgttcatcgtcatgggcgcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcatttttaata
acagttccaactgccctggcgattttctttgcgatattcatcctggtctgcatcgagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgcctcgttgccatg
ggttacctcttcatgtgtttcggagacactgtctctccctgggatcaggtatcgttcttc
ctcttcatcatcttcgtggtgtacactatgctgcccttcaatatgcgagatgccatcatt
gccagtgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcgacg
ccgggggccaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcaggagcctaccataagcacctcatggagcttgctcttcagcaaacatat
caggacacatgtaattgcatcaagtcccggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacatcgctatggagatgaaagcagagatc
attcagaggctgcagggtcccaaggcgggccagatggagaacacaaataacttccacaac
ctgtacgtgaagcggcataccaacgtgagcatcttatatgctgatatcgttggctttacc
cggctggcaagtgactgctccccaggagaactagtccacatgctgaatgagctcttcgga
aagttcgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtttctggacttccaatatctctccctaaccatgccaagaactgtgtgaaa
atgggactggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgcgtgggtgtgcattctgggaatgtcctgtgcggcgtgataggtctgcagaag
tggcagtatgacgtgtggtcccatgatgtgactttggccaatcacatggaagctggaggg
gtccctggacgtgttcacatttcttccgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tacttcgtaatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgt
cacaccctcgatggagccaaaatgagggcctcagtccgcatgacccggtacttggagtcc
tggggggcggccaagccctttgcacacctgcatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtaccgatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaaaagatttgaagaagaattgaatgaaaggatgattcaagca
attgatggaatcaatgcacagaagcaatggctcaagtctgaagatattcagagaatctca
ctgcttttctataacaaagtactagaaaaagaataccgggccacggcactgccagcgttc
aagtattacgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctc
gtgctgccaaaaacatccgtcctgggcatctcctttgggactgcgtttctcctgctggcc
ttcatcctctttgtctgcttcgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctccggcatcattgccaaccgcccctggccacggatt
tctctgacgatcgtcaccacggccatcatactaaccatggctgtgttcaacatgtttttc
ctgagtgactctgaggaaacaatccctccaactgccaatacatcaaacacaagtttttca
gcctcaaataatcaggcagcgattctgcgtgcacaaaatttatttttcctcccgtacttt
atatacagctgcattctgggactgatatcctgttccgtgttcctgcgggtgaactacgag
ctgaagatgctgatcatgatggtggccttggtgggctacaacagcatcctgctccacacc
cacgcccacgtcctgggtgactacagccaggtcttgtttgagagaccaggcatttggaaa
gacctaaagaccatgggctctgtgtctctctctatattcttcatcactctgcttgttctg
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgctt
cctgcgcacgtggctgagcacttcctggccaggagcctgaagaatgaggacctgtaccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagagttttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatt
gctgactttgatgatcttctgtccaagccaaaattcagtggagttgaaaagatcaagacc
attggcagcacatacatggcagcgacaggtctgagtgctgtgcccagccaggagcatgcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgctctg
gtagcaaagctggatgccatcaacaagcactccttcaatgacttcaaactgcgagtgggt
attaaccacggacctgtaatagctggtgtcattggagctcagaagccgcaatatgatatc
tggggcaacaccgtcaatgtggccagtaggatggacagcactggagtcctggacaaaata
caggtcactgaggaaacaagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaatgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaacgtggcgtcctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394265Help
Entry
100394265         CDS       T03264                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100394265 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100394265 (ADCY1)
   04371 Apelin signaling pathway
    100394265 (ADCY1)
   04020 Calcium signaling pathway
    100394265 (ADCY1)
   04072 Phospholipase D signaling pathway
    100394265 (ADCY1)
   04024 cAMP signaling pathway
    100394265 (ADCY1)
   04022 cGMP-PKG signaling pathway
    100394265 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100394265 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100394265 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100394265 (ADCY1)
   04062 Chemokine signaling pathway
    100394265 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    100394265 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    100394265 (ADCY1)
   04912 GnRH signaling pathway
    100394265 (ADCY1)
   04913 Ovarian steroidogenesis
    100394265 (ADCY1)
   04915 Estrogen signaling pathway
    100394265 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    100394265 (ADCY1)
   04921 Oxytocin signaling pathway
    100394265 (ADCY1)
   04926 Relaxin signaling pathway
    100394265 (ADCY1)
   04918 Thyroid hormone synthesis
    100394265 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    100394265 (ADCY1)
   04916 Melanogenesis
    100394265 (ADCY1)
   04925 Aldosterone synthesis and secretion
    100394265 (ADCY1)
   04927 Cortisol synthesis and secretion
    100394265 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100394265 (ADCY1)
   04270 Vascular smooth muscle contraction
    100394265 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    100394265 (ADCY1)
   04971 Gastric acid secretion
    100394265 (ADCY1)
   04972 Pancreatic secretion
    100394265 (ADCY1)
   04976 Bile secretion
    100394265 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100394265 (ADCY1)
   04727 GABAergic synapse
    100394265 (ADCY1)
   04725 Cholinergic synapse
    100394265 (ADCY1)
   04720 Long-term potentiation
    100394265 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    100394265 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100394265 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    100394265 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    100394265 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100394265 (ADCY1)
   04714 Thermogenesis
    100394265 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394265 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    100394265 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100394265 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100394265 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100394265 (ADCY1)
   05163 Human cytomegalovirus infection
    100394265 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100394265 (ADCY1)
   05142 Chagas disease (American trypanosomiasis)
    100394265 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100394265 (ADCY1)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100394265 (ADCY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Motif
Other DBs
NCBI-GeneID: 100394265
NCBI-ProteinID: XP_017831136
Position
8
AA seq 914 aa AA seqDB search
MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNGLELRMSVPLS
RSFPERLGGGQPGIPLSCSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHC
RRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRV
LCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNS
FLKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPF
SNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMAD
LNFFTLQYKHVEREQKYHQLQDEYFTSAVVLTLILAALFGLVYLLIIPQSVAVLLLLVFC
ICFLVACILYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKSN
SSLVVLSSGGQRTALPTLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYI
LVLELSGYTRTGGGAVSGRSYEPIMAILLFSCALALHARQVDIRLRLDYLWAAQAEEERE
DMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIEL
DGNNMGVECLRLLNEIIADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGAKKAPDP
DAYTGEFVTPASKALKGSAFSPPGAASNAFGGPGGMSYTFPTDDRLCGGCFLGINVGPVV
AGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKG
KGEMLTYFLEGRTDGNGSQIRSLGLERKIYPYGRAGLQGRRPPVCPMPGVSFRAGLPPHP
PGQYLPSAAAGKEA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggtgttcgtgcggattctgactgagcgttcgcagaggaaggcgttcctccag
gcccggagctgcatcgaggaccggctgaggctggaggatgagaacgagaagcaggagcgg
ctcctcatgagccttctgccccggaatggtttggagctgcgaatgtctgtacccctctcg
aggtcatttcctgagcggctgggaggagggcagcctggcatccctttgtcttgcagcatc
ctgtttgctgacatcgtgggtttcacgggcttggcatcacagtgcacggcccaggagctg
gtgaaactcctcaacgagctcttcggcaagttcgacgaattagccacggagaaccactgt
cgccgcatcaagattctgggggactgctactactgcgtgtcaggcctcacccagcccaag
actgaccatgcccactgctgtgtggagatggggctcgacatgattgacaccatcacgtcc
gtggctgaagccactgaggtggacctgaacatgcgcgtgggtctgcacacgggcagagtc
ctctgtggtgtcctgggcttgcgcaagtggcagtacgatgtgtggtccaatgatgtgacc
ctagccaatgtcatggaagctgctggcctgccagggaaggttcatataacaaagaccacc
ctagcgtgcttgaatggggactacgaggtagaaccaggttacggacatgagaggaacagt
ttcttgaaaactcataacatcgaaaccttttttattgtgccgtcccaccgccgaaagata
tttccaggcctgattctctcagatataaaaccggccaagaggatgaagttcaagaccgtc
tgctacctgctggtgcagctcatgcactgccggaagatgttcaaggctgagatccccttc
tccaacgtcatgacctgtgaggacgacgacaagcggagggcattaagaacagcctcggaa
aaactcagaaaccgctcatctttttctaccaacgttgtctacaccaccccgggcactcgt
gtcaacaggtacatcagccgcctcttagaagcccgccagacagagctggagatggcagac
ctgaacttctttaccctacagtacaaacatgttgaacgggagcaaaagtaccaccagctt
caggacgagtacttcaccagcgctgttgtcctcaccctcatcctggctgccttatttggc
cttgtctaccttctaataatcccgcagagtgtggccgtcctgctcctgctagtattctgc
atttgcttcctggtggcctgcatcctgtacctgcacatcaccagggtccagtgttttcca
gggtgcctgacgattcagattcgcactgtcctgtgtattttcatagtggtcttaatctac
tcagtagcccaaggatgtgtggtgggctgtctgccctgggcctggagctccaagtccaac
agttccctggtggtcctttcatctgggggccagcgcacagccctgcccaccctgccctgc
gagtctacgcaccatgccctgctctgctgcctggtgggcaccctcccactagccatattt
tttcgggtgtcctccttgccaaaaatgatcctactgtccgggcttaccacttcctacatc
ctcgttctggagctcagcggatacaccaggactgggggtggtgccgtctccgggcgcagc
tacgagccgattatggccatcctgctcttctcctgtgcactggccctgcatgccaggcag
gtggacatcaggctgaggctggactacctctgggctgcacaggcagaggaggagcgagag
gacatggagaaggtgaagctggacaacaggcgcatcctgttcaatctcctgcctgcccac
gtcgcccagcacttcctcatgtccaaccctcggaacatggacctctactaccagtcctac
tcccaggtgggtgtcatgttcgcctccattcccaacttcaacgacttctacattgagctg
gatgggaacaacatgggggtggagtgtctgcggcttctcaacgagatcatcgccgacttt
gatgagctcatggaaaaagacttttacaaagacatagagaagatcaagaccatcgggagc
acctatatggccgctgtggggctagcgcccacctcgggggccaagaaagcaccagatcca
gatgcatacactggtgaattcgtgaccccagcaagcaaggccctgaaaggatcagccttc
tctccaccaggagcagcatcaaatgcatttggtggccctggtgggatgagttacactttt
cccactgatgacaggttgtgcgggggctgttttctaggcatcaacgttgggccggtggtg
gctggagtgattggcgctcgcaggccccagtacgacatctggggaaacacagtcaacgtg
gccagtcggatggacagcacaggggtccagggcagaatccaggtgactgaggaagtccac
cggctgctgagaagatgcccctaccactttgtgtgccgaggcaaagtcagtgtcaagggc
aaaggcgagatgctgacatactttctagaaggcaggactgatggaaacggctcccaaatc
aggtccctgggcttggagcggaaaatatatccatatgggagagctggccttcagggcaga
cgtcccccagtgtgccccatgcctggagtttcattcagggctgggctccctccacacccc
ccgggccagtacctgccttctgcagcagctgggaaggaggcttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404484Help
Entry
100404484         CDS       T03264                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100404484 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100404484 (ADCY8)
   04371 Apelin signaling pathway
    100404484 (ADCY8)
   04020 Calcium signaling pathway
    100404484 (ADCY8)
   04072 Phospholipase D signaling pathway
    100404484 (ADCY8)
   04024 cAMP signaling pathway
    100404484 (ADCY8)
   04022 cGMP-PKG signaling pathway
    100404484 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100404484 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100404484 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404484 (ADCY8)
   04062 Chemokine signaling pathway
    100404484 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    100404484 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    100404484 (ADCY8)
   04912 GnRH signaling pathway
    100404484 (ADCY8)
   04913 Ovarian steroidogenesis
    100404484 (ADCY8)
   04915 Estrogen signaling pathway
    100404484 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    100404484 (ADCY8)
   04921 Oxytocin signaling pathway
    100404484 (ADCY8)
   04926 Relaxin signaling pathway
    100404484 (ADCY8)
   04918 Thyroid hormone synthesis
    100404484 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    100404484 (ADCY8)
   04916 Melanogenesis
    100404484 (ADCY8)
   04925 Aldosterone synthesis and secretion
    100404484 (ADCY8)
   04927 Cortisol synthesis and secretion
    100404484 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100404484 (ADCY8)
   04270 Vascular smooth muscle contraction
    100404484 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    100404484 (ADCY8)
   04971 Gastric acid secretion
    100404484 (ADCY8)
   04972 Pancreatic secretion
    100404484 (ADCY8)
   04976 Bile secretion
    100404484 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    100404484 (ADCY8)
   04727 GABAergic synapse
    100404484 (ADCY8)
   04725 Cholinergic synapse
    100404484 (ADCY8)
   04720 Long-term potentiation
    100404484 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    100404484 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    100404484 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    100404484 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    100404484 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    100404484 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100404484 (ADCY8)
   04714 Thermogenesis
    100404484 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404484 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    100404484 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100404484 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100404484 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404484 (ADCY8)
   05163 Human cytomegalovirus infection
    100404484 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100404484 (ADCY8)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100404484 (ADCY8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 100404484
NCBI-ProteinID: XP_002807688
Ensembl: ENSCJAG00000004325
Position
16
AA seq 1252 aa AA seqDB search
MELSDVRCLTGSEELYTIHPTPPAGDGRSSSRPQRLLWQTAVRHITEQRFIHGHRGGSGG
GSGGSSKASDPAGAGPNHHHAPQLSGDSGLPLYSLGPGERAHSTCGTKVFPERSGSGSAS
GSGGGGDLGFLNLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRR
KSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSH
TYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGT
SLLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEA
RLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFAD
VKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHA
HCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANK
LESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPE
DIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCA
FIVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLLLRKTCCWIN
ETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFT
GVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKE
ASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHV
ARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFD
ELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINK
HSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLI
LKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL
VQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKPDLP
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcagctcccggccgcagcggctgctgtggcagacg
gcggtgcggcacatcacggagcagcgtttcattcacgggcaccggggaggcagcggcggt
gggagcggaggctccagcaaagcctcggaccccgcgggcgccggccccaaccaccaccac
gcgccgcagctgtcaggcgactcggggctgcccctctactcgcttggcccgggagagcga
gcgcacagcacctgcggcactaaagtcttcccggaacgaagcgggagcggcagtgccagc
ggcagcgggggcgggggcgacttgggcttcctgaaccttgactgtgccccgagcaactcg
gatttcttcctcaacgggggctacagctacagaggggtgattttccccaccttacgcaac
tccttcaagtctcgggatttggaacgcctctaccagcgctatttcttgggccagaggcgc
aaatcagaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctg
cacttgagcctggcctccgccccgatggacccgctcaagggcatcctgctgggcttcttc
accggcattgaggtggtgatctgcgccctggtggtggtcaggaaagacaccacctcgcac
acgtaccttcagtacagtggcgtggtcacctgggtggccatgaccacccagatcctggca
gcaggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttt
gccacctacagcatgctgccgctgccgctcacctgggccatcctggccggcctgggcacc
tcactgctgcaggtgatcctccaagtggtcatccctcggctggcggtcatttccatcaac
caggttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagt
tacctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggcc
aggctgcgcctagagacagagaaccaaagacaggagcggctggttctttctgtgctcccc
cggtttgtggtcctggaaatgatcaacgacatgaccaatgtggaagacgagcacctgcag
caccagttccatcggatctacatccaccgctatgagaatgtcagtattcttttcgcagat
gttaaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctc
aacgagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaa
atcctgggggactgctactactgcgtgtccggacttcctgagccccgccaggaccatgcc
cactgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaagg
acaaaacacgatgttgacatgaggattggaatccactcaggctcggtgctgtgtggtgtt
ttgggactaaggaagtggcaatttgatgtctggtcttgggatgtggacattgcaaacaaa
ctcgaatctggaggaatccctgggaggattcacatttccaaagccacgctggactgtctc
aacggtgactataacgtggaagagggtcatggtaaagagaggaatgaattcctgaggaag
cataatatagagacttacttaattaagcagcctgaggacagtctgctgtccttgcctgaa
gatattgtcaaagagtcagtgagctcctcagaccggagaaacagtggggccacgttcact
gaaggatcctggagccctgaactgcccttcgataatatcgtggggaaacagaatactctg
gctgccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcat
gtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagt
ggcgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagc
ctggagcataagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgca
tttatcgttcttctgtttatcacggcaatacaaagtttgcttccttcttcaagagtgatg
ccaatgaccatccagttctccattctgattatgctgcactcggctctggtcctcatcacc
acggcagaggattacaagtgtttgcccctcctcctccggaaaacttgctgttggattaat
gagacctatttggcccggaacgtcatcatctttgcatccatcttgattaattttctgggt
gccatcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgact
ttcaattcctcagctgtatttacagatatctgctcctacccagagtactttgtcttcact
ggggtgttggccatggtgacctgtgcagttttcctccggctgaactctgtcctgaagctg
gcagtgctgctgatcatgattgccatctatgccctgcttactgagaccgtctatgcaggc
ctctttctgcgttatgacaacctcaaccacagtggagaagatttcctggggaccaaggag
gcctcgctgctgctgatggccatgttccttctggctgtgttctaccatggacagcagctg
gagtacacggcccgcttggacttcctttggcgagtgcaggccaaagaggagatcaatgag
atgaaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccacgtg
gcccgccatttcctagagaaagaccgagacaatgaggagctatattctcaatcctatgat
gctgttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgag
atgaataaccagggagtggaatgcctgcgcttgctgaatgagatcattgctgacttcgat
gagttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacc
tacatggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaaatggggacat
ctgtgtgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaag
cattcattcaacaattttgagctccggattggcatcagccatggctcagtggtagctggc
gttatcggcgctaagaagccacagtatgacatttggggcaaaactgtgaacctggcaagc
cgaatggacagcacaggggttagtggccgaatccaagtcccagaggagacctatctcatc
ctgaaagatcagggctttgcctttgactaccgaggggagatctacgtaaaaggcattagt
gaacaggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattc
atcttgcccccaagaagactgcctgggcagtactccctggctgcagttgtcctgggactt
gtccagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacggga
attatcaagggtcattacaaccggcggactttgttgtcacccagcgggacagagcctgga
gcccaggctgaaggcaccgacaaacctgatttgccataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404620Help
Entry
100404620         CDS       T03264                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100404620 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100404620 (ADCY7)
   04371 Apelin signaling pathway
    100404620 (ADCY7)
   04020 Calcium signaling pathway
    100404620 (ADCY7)
   04072 Phospholipase D signaling pathway
    100404620 (ADCY7)
   04024 cAMP signaling pathway
    100404620 (ADCY7)
   04022 cGMP-PKG signaling pathway
    100404620 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100404620 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100404620 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404620 (ADCY7)
   04062 Chemokine signaling pathway
    100404620 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    100404620 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    100404620 (ADCY7)
   04912 GnRH signaling pathway
    100404620 (ADCY7)
   04913 Ovarian steroidogenesis
    100404620 (ADCY7)
   04915 Estrogen signaling pathway
    100404620 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    100404620 (ADCY7)
   04921 Oxytocin signaling pathway
    100404620 (ADCY7)
   04926 Relaxin signaling pathway
    100404620 (ADCY7)
   04918 Thyroid hormone synthesis
    100404620 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    100404620 (ADCY7)
   04916 Melanogenesis
    100404620 (ADCY7)
   04925 Aldosterone synthesis and secretion
    100404620 (ADCY7)
   04927 Cortisol synthesis and secretion
    100404620 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100404620 (ADCY7)
   04270 Vascular smooth muscle contraction
    100404620 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    100404620 (ADCY7)
   04971 Gastric acid secretion
    100404620 (ADCY7)
   04972 Pancreatic secretion
    100404620 (ADCY7)
   04976 Bile secretion
    100404620 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100404620 (ADCY7)
   04727 GABAergic synapse
    100404620 (ADCY7)
   04725 Cholinergic synapse
    100404620 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    100404620 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100404620 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    100404620 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    100404620 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100404620 (ADCY7)
   04714 Thermogenesis
    100404620 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404620 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    100404620 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100404620 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100404620 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404620 (ADCY7)
   05163 Human cytomegalovirus infection
    100404620 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100404620 (ADCY7)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100404620 (ADCY7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Motif
Other DBs
NCBI-GeneID: 100404620
NCBI-ProteinID: XP_017822387
Ensembl: ENSCJAG00000001898
Position
20
AA seq 1081 aa AA seqDB search
MPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLTLLLVAVIACLALIIIAFSHGDPS
RHQAILGTAFLVLAVFLALSVLVYVECLLRRWLRALALLAWACLMTLGYVLVFDAWTKAA
CSWEQVPFFLFVVFVVYTLLPFSMRGAVAVGVISTASHLLVLCALMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKNQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCVPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPRQQPPRSKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGQKPKSIPHRHRRTPDRCVLCPLGQ
SVEDDSYDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHHFAC
ASLIFICILLVHVLLMPRTVVLGVSFGLVACVLGLVLGLCFATEFLRCCPAQGILRTISE
RVEMQPLLRLTLAVLTIGSLLTVAIVNLPLMPFPVPELPFGNETGLLAMSSKARALCEPL
PYYTCSCILGFIACSVFLRMSLEPKVVLLTVALIAYLVLFNLSPCWQWDCSSQGLGNLTE
PNSTTSGTPSCSWRDLKTMINFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFE
TMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNK
EGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVTSGHENQELERQHA
HIGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVA
SRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGL
N
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaagggccgatacttcctcaacgagggtgaggagggccctgaccaagatgcg
ctctacgagaagtaccgtctcaccagccagcacgggccgctgctgctcacgctcctgctg
gtggctgtcatcgcctgcctggcgctcattatcatcgccttcagccacggggacccctcc
agacaccaggccattctgggcacggcgttcctggtgctggcagtgtttttggccctctct
gtgctggtgtatgtcgagtgtctcctgaggcgctggctcagggccttggcgctgcttgcc
tgggcctgcctgatgaccctgggctacgtgctggtgtttgacgcgtggacgaaggctgcc
tgttcgtgggagcaggtgcccttcttcctgttcgttgtcttcgtggtgtacacgctgctg
cccttcagcatgcggggggctgtggctgtaggggtcatctccaccgcctcccacctcctg
gtactctgcgctctgatgggaggcttcacaacgcccagcgtccgggtagggctacagctg
ctggccaacgcggtcatcttcctgtgcgggaacctgactggtgccttccacaagaaccag
atgcaggatgcatcccgggacctcttcacctacactgtgaagtgcatccagatccgccgg
aagctgcgcattgagaagcgccagcaggagaacctgctgctgtcggtgctcccggcccac
atctctatgggcatgaagctggccatcattgagcggctcaaggagcatggcgaccgccgc
tgtgtgcccgacaacaacttccacagcctctacgtcaagcggcaccagaatgtcagcatc
ctctatgcggacatcgtgggcttcacgcggctggccagcgactgctcccccaaggaactg
gtggtggtactgaacgagctctttggcaaatttgaccagatcgccaaggccaacgagtgc
atgcggatcaagatcctcggcgactgctactactgtgtgtcaggcctgcctgtgtcgctg
cccacccacgcccggaactgcgtgaagatggggctggacatgtgcgaggccattaagcag
gtgcgggaggccacaggcgtggacatcaacatgcgtgtgggcatacactctgggaatgtg
ctgtgcggggtcatcgggctgcgcaagtggcagtatgacgtgtggtcccatgacgtgtcc
ctggccaaccggatggaggcagccggagtccccggccgggtgcacatcacggaggcaaca
ctgaagcacctggacaaggcgtatgaggtggaggatgggcacgggcagcagcgggacccc
tacctcaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagcca
cccccgccgaggcaacagccccccaggtccaagggggacgcggccctgaagatgcgggcg
tcagtgcgcatgacccgctacctcgagtcctggggggcagctcggccctttgcgcacctc
aaccatcgtgagagtgtgagcagtggcgagacccctgtccctaatgggcagaagcccaag
agcattccccatcgccaccgccggacccctgacaggtgcgtgctctgccctcttggccaa
agtgtggaggacgactcgtatgacgagatgctgtcagccatcgaggggctcagctccacg
aggccctgctgctccaagtctgacgacttctacacctttgggtccatcttcctggagaag
ggctttgagcgcgagtaccgcctggcgcccatcccccgggcccgccaccacttcgcctgc
gccagcctgatcttcatctgcattctgcttgtccatgtcctcctcatgcccaggacggtg
gtgctgggtgtgtccttcgggctggtggcctgtgtgctggggctggtgctgggcctctgc
tttgccaccgagttcttgaggtgctgcccagcccaggggatactccgcactatctccgag
agggtggagatgcagcccctgctgaggctgaccctggctgtcctgaccatcggcagcctg
ctcaccgtggccattgtcaacctgcccctgatgcctttcccagtcccagagctgcctttc
ggcaacgagacaggcctgctggccatgagcagcaaggcaagggccctgtgtgagcccctc
ccgtactacacctgcagctgcatcctgggcttcatcgcctgctccgtcttcctgcggatg
agcctggagccaaaggttgtgctgctgacagtggccctgatagcctacctggtgctcttc
aacctctccccgtgctggcagtgggactgctccagccaaggcctgggcaacctcaccgag
cccaacagcaccaccagcggcacccctagctgttcctggagggacctgaagaccatgatc
aatttctacctggtcctgttctacatcaccctgctcacgctctccagacagattgactat
tactgccgcctggactgcctatggaagaagaagttcaagaaggagcacgaggagtttgag
accatggagaacgtgaatcgccttcttctggagaacgtcctgccagcccatgtggccgcc
cacttcattggtgacaagttaaatgaggactggtaccatcagtcgtatgactgcgtctgt
gtcatgtttgcctctgtgccagacttcaaagtgttctacacagagtgcgacgtcaacaaa
gaaggtctggagtgcctccgcctgctcaacgagatcattgccgactttgatgagctcctg
ctgaagcccaagttcagtggtgtggagaagatcaagaccattggcagcacatacatggca
gctgcagggctcagcgtcacctcggggcacgagaaccaggagctggagcggcagcatgcc
cacattggtgtcatggtggagttcagcatcgccttgatgagcaagctggacggcatcaac
aggcactccttcaactccttccgcctccgcgttggtataaaccatgggcctgtgattgct
ggagtgataggggcccgaaaacctcagtatgacatctggggaaacacggtcaacgtggcc
agccgaatggagagcactggagaacttgggaaaatccaggttactgaggagacctgcacc
atcctccagggcctcgggtactcatgtgaatgccgtggcctgatcaacgtcaaaggcaaa
ggcgagctgaggacttattttgtctgtacggacactgccaagtttcaggggctggggctg
aactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405403Help
Entry
100405403         CDS       T03264                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100405403 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100405403 (ADCY9)
   04371 Apelin signaling pathway
    100405403 (ADCY9)
   04020 Calcium signaling pathway
    100405403 (ADCY9)
   04072 Phospholipase D signaling pathway
    100405403 (ADCY9)
   04024 cAMP signaling pathway
    100405403 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100405403 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100405403 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100405403 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100405403 (ADCY9)
   04062 Chemokine signaling pathway
    100405403 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100405403 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100405403 (ADCY9)
   04912 GnRH signaling pathway
    100405403 (ADCY9)
   04913 Ovarian steroidogenesis
    100405403 (ADCY9)
   04915 Estrogen signaling pathway
    100405403 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100405403 (ADCY9)
   04921 Oxytocin signaling pathway
    100405403 (ADCY9)
   04926 Relaxin signaling pathway
    100405403 (ADCY9)
   04918 Thyroid hormone synthesis
    100405403 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100405403 (ADCY9)
   04916 Melanogenesis
    100405403 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100405403 (ADCY9)
   04927 Cortisol synthesis and secretion
    100405403 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100405403 (ADCY9)
   04270 Vascular smooth muscle contraction
    100405403 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100405403 (ADCY9)
   04971 Gastric acid secretion
    100405403 (ADCY9)
   04972 Pancreatic secretion
    100405403 (ADCY9)
   04976 Bile secretion
    100405403 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100405403 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100405403 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100405403 (ADCY9)
   04727 GABAergic synapse
    100405403 (ADCY9)
   04725 Cholinergic synapse
    100405403 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100405403 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100405403 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100405403 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100405403 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100405403 (ADCY9)
   04714 Thermogenesis
    100405403 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405403 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100405403 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100405403 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100405403 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100405403 (ADCY9)
   05163 Human cytomegalovirus infection
    100405403 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100405403 (ADCY9)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100405403 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF512 DUF1053
Motif
Other DBs
NCBI-GeneID: 100405403
NCBI-ProteinID: XP_002755917
Ensembl: ENSCJAG00000019746
UniProt: F6RS83
Position
12
AA seq 1353 aa AA seqDB search
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGSGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYVWTSLALT
LLVFALTLAAQFQVLTPVSGLGDSSNLTAAAQPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRALLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
YATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLISGQRAKESPCSCAEALLSGFEVIGGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCSSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGSNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRSSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSITCFLKYGAATAPPPPAALAVFSTALLLEMLSLAVSVR
MVFFLEDVMACTKRLLEWVAGWLPRHCIGAILVSLPALAVYSHVTSEFETNVHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYASLCPDSSVLTSPLDAVQNFSSER
NPCNSSLPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHGVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYADKTSLGSNSGSQAKDAHLSPKRPWKEPIKAEE
GGQFGKAIEKDDCDDTGMEEANELTKLNVSKSV
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaagtacagcatctcctccagctgcagcagctccggggactcc
gggggtgtcccccggcgagtgggcagcggaggccgccttcgcaggcagaagaagctcccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtaaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcactc
ttctacattggctttgcttgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgctctgtgcttcctcctggtgtgcgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgtgtggacctcgctggccctcacc
ctgctggtgttcgccctgaccctggctgcacagttccaggtcttgacgcctgtctcagga
ctgggcgacagctccaatctgacggctgcagcccagcccacggacacgtgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctcttcttgctctacaccgtcatgcacttg
cctttgtacttgagcttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgttgagcagggcgctgctccacggttgcatccatgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggttggacagtccatcatgcacggg
aaggacttggaagtggagaaagcccttaaagagaggatgattcactccgtgatgccaaga
atcatagccgacgacttaatgaagcagggggatgaggagagtgagaattctgtcaagagg
tatgccacctcgagccccaagaataggaagaagaagtcttccatacaaaaagctcctatt
gccttccgcccttttaagatgcagcagatcgaggaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtccgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaagatcagcact
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcattgagatggggctgggcatgatcaaggccattgagcagttctgccaggagaag
aaggaaatggtgaacatgcgggtcggggttcacacgggcaccgtcctgtgtggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggggtggccggcaaagttcacatttctgaggccactgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttacggaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcct
tgcagctgtgcagaggccttgctttctggctttgaggtcattggcggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgctcttcatgcggaatcacatttgctcccaaa
tccgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggatctaatcccaaaactcagaacgggctcctgagccctccc
caggaggagaagctcaccaacagtcagacatctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcagctctccttccgctgaggttcaagaatatc
cgggagaaaacggatgcccacttcgtagacgtcatcaaggaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggagcagctatcaggaagaggtcatcaagaactcccccgtgaagacgttt
gccagtcccaccttcagctccctcctggacgtgtttctgtcgaccacagtgtttctgacg
ctgtccatcacctgcttcctgaagtacggggcggccaccgcacctcccccaccggctgcc
ctggcagtcttcagcacggccctgcttttggagatgctgtccctcgcggtgtccgtcagg
atggtgttcttcctggaggacgtcatggcttgcaccaagcgcctgctggagtgggtcgcc
ggctggttgccgcgtcactgcatcggggccatcctggtgtcgctccctgccctggccgtc
tactcccacgtcacctccgaatttgagacaaacgtacatttcccggtgttcacaggctca
gccgcgctgatcgccgtcgtgcactactgtaacttctgccagctcagctcttggatgagg
tcctcccttgccaccgtcgtgggggccgggccgctgctcctgctctatgcctccctgtgc
ccagacagttctgtattaacttcgccccttgacgccgtacagaatttcagttctgagagg
aacccgtgcaatagctcgctgccgcgtgacctccggcggccggcaagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaaccgcgaattt
gaagtcagctaccgcctccactaccatggggatgtggaagcggacctccaccgcaccaag
atccagagcatgcgggaccaggcggactggctgctgaggaacatcatcccctaccatgtg
gccgagcagctgaaggtttcccagacctactccaagaaccacgacagcggaggggtgatt
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggtggcaaggag
tgctaccgggtcctcaacgagctcatcggggacttcgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcggggctg
aacaccgcgcaggcacaggacggcagccacccgcaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtagacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcatcggcttcaaccacgggcccctcacggcgggggtcatcggtaccacc
aagctgctgtacgacatctggggggacaccgtcaacatcgccagcaggatggacaccacc
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcctgagcaagatgggc
tacgacttcgactacagagggaccgtgaacgtcaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacagaccacggggtcatcccgcagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacggacgagattgccaac
ctggtgccttctgtccagtatgcggacaagacgtctctgggctccaacagcggctcgcag
gccaaggatgctcacctgtcccccaagagaccctggaaggagcccatcaaagcagaagaa
gggggtcagtttggcaaagccatagagaaagacgactgtgacgacacgggcatggaagaa
gccaatgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406617Help
Entry
100406617         CDS       T03264                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100406617 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100406617 (ADCY6)
   04371 Apelin signaling pathway
    100406617 (ADCY6)
   04072 Phospholipase D signaling pathway
    100406617 (ADCY6)
   04024 cAMP signaling pathway
    100406617 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100406617 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100406617 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100406617 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100406617 (ADCY6)
   04062 Chemokine signaling pathway
    100406617 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100406617 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100406617 (ADCY6)
   04912 GnRH signaling pathway
    100406617 (ADCY6)
   04913 Ovarian steroidogenesis
    100406617 (ADCY6)
   04915 Estrogen signaling pathway
    100406617 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100406617 (ADCY6)
   04921 Oxytocin signaling pathway
    100406617 (ADCY6)
   04926 Relaxin signaling pathway
    100406617 (ADCY6)
   04918 Thyroid hormone synthesis
    100406617 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100406617 (ADCY6)
   04916 Melanogenesis
    100406617 (ADCY6)
   04924 Renin secretion
    100406617 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100406617 (ADCY6)
   04927 Cortisol synthesis and secretion
    100406617 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100406617 (ADCY6)
   04270 Vascular smooth muscle contraction
    100406617 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100406617 (ADCY6)
   04971 Gastric acid secretion
    100406617 (ADCY6)
   04972 Pancreatic secretion
    100406617 (ADCY6)
   04976 Bile secretion
    100406617 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100406617 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100406617 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100406617 (ADCY6)
   04727 GABAergic synapse
    100406617 (ADCY6)
   04725 Cholinergic synapse
    100406617 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100406617 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100406617 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100406617 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100406617 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100406617 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100406617 (ADCY6)
   04714 Thermogenesis
    100406617 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406617 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100406617 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100406617 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100406617 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100406617 (ADCY6)
   05163 Human cytomegalovirus infection
    100406617 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100406617 (ADCY6)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100406617 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa DUF2339
Motif
Other DBs
NCBI-GeneID: 100406617
NCBI-ProteinID: XP_017831511
Ensembl: ENSCJAG00000020756
Position
9
AA seq 1089 aa AA seqDB search
MELGLRAVALGFEDTDMTPAGGGTAEVAPDAVPRSRRSCWGRLVQVFQSKQFRSAKLERL
YQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVALMVVCN
RHSFRQDSMWVVSYVVLGILAAVQVGGALAADPHSPSAGLWCPVFFVYIAYTLLPIRMRA
AVLSGLGLSTLHLILAWQLNRSDAFLWKQLSANVLLFLCTNVIGICTHYPAEVSQRQAFQ
ETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVS
ILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEA
RADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDV
TLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKR
KEEKAMLAKLQRARANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGAQDALN
PEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLV
FCFICFIQLLVFPHSTLMLGIYASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSR
AHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAAQMLNLTPADITACHLQQLNYSLGLD
VPLCEDTEPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPA
TIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVEST
ARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVA
VMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEQFRQLEKIKTIGSTYMA
ASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGA
RKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLEYRGVVKVKGKGEMTT
YFLNGGPSS
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggagctggggctgcgagcagtggccctgggcttcgaggacaccgacatgactccggca
gggggcgggacggctgaggtggcccccgacgctgtgcccaggagccggcgatcctgctgg
gggcgtctagtgcaggtgttccagtcgaagcagttccgttcagccaaactggagcgcctg
taccagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctg
gtgctgctcaccgcggtgctgctggccttccatgccgcgcccgcccgccctcagcctgcc
tatgtggccctgctggcctgcgccgccgccctatttgtggctctcatggtggtgtgtaac
cggcatagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctg
gcggcagtgcaggtggggggcgccctcgcagctgacccgcacagcccctctgcaggcctc
tggtgccccgtgttcttcgtctacatcgcctacacgctcctccccatccgcatgagggct
gctgtcctcagcggtctgggcctctccaccctgcatttgatcttggcctggcaactcaac
cgtagtgatgccttcctctggaagcagctcagtgccaatgtgctgctgttcctctgcacc
aacgtcattggcatctgcacacattacccagcagaggtgtctcagcgccaggcctttcag
gagacccgaggttatatccaggcccgactccacctacagcatgagaatcggcagcaggag
cggttgctgctgtcggtattgccccagcatgttgccatggagatgaaagaagacatcaac
acaaaaaaagaagacatgatgttccacaagatctacatacagaagcatgacaacgtcagc
atcctgtttgcagacattgagggcttcaccagcctggcatcccagtgcaccgcgcaggag
ctggtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggaaaatcac
tgcctgaggatcaagatcttgggggactgttactactgtgtgtcagggttaccagaggcc
cgggcagaccatgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcg
ctggtacgtgaggtgacaggtgtaaatgtgaacatgcgcgtgggcatccacagcggacgt
gtgcactgtggtgtccttggcctgcggaaatggcagttcgatgtgtggtccaatgacgtg
accctggccaaccacatggaggcaggaggccgggccggccgcatccacatcactcgggca
acgctgcaatacctgaacggggactacgaggtggagccaggccgtggtggcgagcgcaac
gcatacctcaaggagcagcacattgagactttcctcatcctgggtgccagccagaaacgg
aaagaggagaaggccatgctggccaagctgcagcgggcccgggccaactccatggaaggg
ctgatgccacgctgggttcccgatcgtgccttctccaggaccaaggactccaaggccttc
cgccagatgggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaac
cctgaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcatagatcag
ctgcggaaggaccacgtgcgccggtttctgctcaccttccagagagaggatcttgagaag
aagtactcccggaaggtggatccccgctttggagcctacgttgcctgtgccctgttggtc
ttctgcttcatctgcttcatccagcttctcgtcttcccacactccaccctgatgcttggg
atctatgccagcatcttcctgctgctgctgatcaccgtgctgatctgtgctgtatactcc
tgtggttctctgttccctaaggccctgcaacgtctgtcccgcagcatcgtccgctcgcgg
gcacacagcactgcagttggcatcttttctgttctgcttgtgtttacctctgccattgcc
aacatgttcacctgtaaccacacccccatacggacctgtgcagcccagatgctgaattta
acacctgctgatatcactgcctgccacctgcagcagctcaattactctctgggcctggat
gtgcccctgtgtgaggacaccgagcccacctgcagcttccctgagtacttcatcgggaac
atgctgctgagtctcctggccagctctgtcttcctgcacatcagcagcatcgggaagttg
gccatgatctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagcc
accatctttgacaactatgacctactgcttggtgtccatggcttggcttcttccaatgag
acctttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccct
gtgattctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgact
gctcgcctggacttcctctggaaactgcaggcaacaggagagaaggaggagatggaggag
ctccaggcatacaaccggaggctgctgcataacattctacccaaggacgtggccgcccac
ttcctggcccgggagcgtcgcaatgatgaactctactatcagtcgtgtgagtgtgtggct
gttatgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaat
gagggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagatcatc
agcgaggagcagttccggcagctggaaaagatcaagacaattggtagcacctacatggct
gcctcagggctgaatgccagcacctacgatcaggtgggccgctcccacatcactgccctg
gctgactacgccatgcggctcatggagcagatgaagcacatcaatgagcactctttcaac
aatttccagatgaagattgggctgaacatgggcccagttgtggcaggtgtcattggggcc
cggaagccgcagtatgacatctgggggaacacagtgaatgtttctagccgtatggacagc
acgggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaag
ggctaccagctggagtatcgaggggtggtcaaggtgaagggcaagggggagatgaccacc
tacttcctcaatgggggccccagcagttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412782Help
Entry
100412782         CDS       T03264                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05012  Parkinson disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05034  Alcoholism
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100412782 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100412782 (ADCY5)
   04371 Apelin signaling pathway
    100412782 (ADCY5)
   04072 Phospholipase D signaling pathway
    100412782 (ADCY5)
   04024 cAMP signaling pathway
    100412782 (ADCY5)
   04022 cGMP-PKG signaling pathway
    100412782 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100412782 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100412782 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100412782 (ADCY5)
   04062 Chemokine signaling pathway
    100412782 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    100412782 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    100412782 (ADCY5)
   04912 GnRH signaling pathway
    100412782 (ADCY5)
   04913 Ovarian steroidogenesis
    100412782 (ADCY5)
   04915 Estrogen signaling pathway
    100412782 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    100412782 (ADCY5)
   04921 Oxytocin signaling pathway
    100412782 (ADCY5)
   04926 Relaxin signaling pathway
    100412782 (ADCY5)
   04918 Thyroid hormone synthesis
    100412782 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    100412782 (ADCY5)
   04916 Melanogenesis
    100412782 (ADCY5)
   04924 Renin secretion
    100412782 (ADCY5)
   04925 Aldosterone synthesis and secretion
    100412782 (ADCY5)
   04927 Cortisol synthesis and secretion
    100412782 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100412782 (ADCY5)
   04270 Vascular smooth muscle contraction
    100412782 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    100412782 (ADCY5)
   04971 Gastric acid secretion
    100412782 (ADCY5)
   04972 Pancreatic secretion
    100412782 (ADCY5)
   04976 Bile secretion
    100412782 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100412782 (ADCY5)
   04727 GABAergic synapse
    100412782 (ADCY5)
   04725 Cholinergic synapse
    100412782 (ADCY5)
   04728 Dopaminergic synapse
    100412782 (ADCY5)
   04726 Serotonergic synapse
    100412782 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    100412782 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100412782 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    100412782 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    100412782 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100412782 (ADCY5)
   04714 Thermogenesis
    100412782 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412782 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100412782 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    100412782 (ADCY5)
   05031 Amphetamine addiction
    100412782 (ADCY5)
   05032 Morphine addiction
    100412782 (ADCY5)
   05034 Alcoholism
    100412782 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100412782 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100412782 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100412782 (ADCY5)
   05163 Human cytomegalovirus infection
    100412782 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100412782 (ADCY5)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100412782 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD HILPDA
Motif
Other DBs
NCBI-GeneID: 100412782
NCBI-ProteinID: XP_008980581
Ensembl: ENSCJAG00000007619
Position
15
AA seq 1005 aa AA seqDB search
MLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGLACY
ALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHLA
IALRTNTQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQR
ENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLAS
QCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMD
MIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGR
IHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQR
TNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRA
IDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITIV
PHSIFMLSFYLTCFLLLTLVVFVSVIYSCIKLFPSPLQTLSRKIVRSKMNSTLVGVFTIT
LVFLAAFVNMFTCNSKDLLGCLAQEHNISTSQVNACHVVESAVNYSLGDERGFCDSPWPN
CNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNADLLVT
ANAIDFNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQAT
EEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEF
YVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKA
GKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTV
NVASRMDSTGVPDRIQVTTDMYQCWLPTPTSWSAGVWSRSRAKAR
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggccgtgttggtgctcgtatgcctggtcatgttggccttccacgcggcgcgg
cccccgctccagctgccctacctggcggtgctggcggccgcggtgggcgtgatcctcatc
atggctgtgctctgcaaccgtgccgccttccaccaggaccacatgggcctggcctgctat
gcgctcatcgccgtggttctggccgtccaggtggtgggtctgctgctgccacagcctcgc
agcgcctccgagggcatctggtggaccgtgttcttcatctacaccatctacacgctgctg
cccgtgcgcatgcgggccgcggtgctcagcggggtgctcctgtccgccctccacctggcc
attgccctgcgcaccaacacccaggaccagttcctgctcaaacagcttgtctccaatgtt
ctcattttctcctgcaccaacatcgtgggcgtctgcacccactacccggctgaggtctcc
cagaggcaggctttccaggagacccgagagtgtatccaggcgcggctccactcacagagg
gagaaccagcagcaggagcggctcctgctgtctgtccttccccgtcatgttgccatggag
atgaaagcagacatcaacgccaagcaggaggatatgatgttccataagatttacatccag
aaacatgacaacgtgagcatcctgtttgctgacatcgagggtttcaccagcctggcatcc
cagtgcactgcacaggaactggtcatgaccctcaacgagctcttcgcacgctttgacaag
ctggccgcagagaatcactgtttacgtattaagatcctcggggattgttattactgcgtc
tcggggctgcctgaagcgagggctgaccatgcccactgctgtgtggagatgggcatggac
atgatcgaggccatctcgttggtccgggaggtgacgggggtgaacgtgaacatgcgtgtg
ggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaagtggcagttcgac
gtctggtctaacgacgtcacgctagccaaccacatggaggctggtggcaaggcaggacgc
atccacatcaccaaggctacactcaactacctgaatggggactacgaggtggagccgggc
tgtgggggcgagcgcaacgcctacctcaaggagcacagtattgagaccttcctcatcctg
cgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatgaaccgccagaga
accaactccatcgggcacaacccaccccactggggggccgagcgccccttctacaaccac
ctgggtggtaaccaggtgtccaaggagatgaagcggatgggctttgaagaccccaaggac
aagaatgcccaggagagtgcaaaccctgaggatgaagtggatgagtttctgggccgcgcc
attgatgccaggagcattgataggcttcggtctgagcatgtccgcaagttcctcttgacc
ttcagggagcctgacttagagaagaagtactccaagcaggtggacgaccgatttggtgcc
tatgtggcatgtgcctcgctcgtcttcctcttcatctgctttgtccagatcaccatcgtg
ccccactccatattcatgctcagcttctacctgacctgtttcctgctgctgaccttggtg
gtgtttgtgtctgtgatctactcctgcataaagctcttcccctccccgctgcagactctc
tccaggaagatcgtgcggtccaagatgaacagcaccctggttggggtgttcaccatcact
ctggtgttcctggcggcttttgtcaacatgttcacgtgcaactccaaggacctgctgggc
tgcttggcacaggagcacaacatcagcacaagccaggtcaacgcatgccacgtggtagag
tcggccgtcaactatagcctgggcgacgagcggggcttctgcgacagcccctggcccaac
tgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctggcctgctccgtg
ttcctgcagatcagttgcatcgggaagctggtgctcatgctggccatcgagctcatctac
gtgctcgtcgtggaggtgccaggtgtcacgctgttcgacaatgccgacctgctggtcacc
gccaatgccatagacttcaacaacaacgggacctcccagtgccctgagcacgcaaccaag
gtggcactgaaggtggtgacacccatcatcatctcagtctttgtgctggccctgtacctg
catgcccagcaggtggagtccactgcccgcctcgacttcctctggaaactgcaggctaca
gaggagaaggaggagatggaggagctgcaggcctataaccggcggctactgcacaacatc
ctgcccaaggacgtggccgctcacttcctggcccgtgagcggcgcaacgatgagctctac
tatcagtcctgtgagtgtgtggcggtcatgtttgcctccatcgccaacttctccgagttc
tacgtcgagctggaggccaacaacgagggtgtcgagtgcctgcggctgctcaacgagatc
atcgctgacttcgatgagatcatcagtgaggatcggttcaggcagctggagaagatcaag
accattggcagcacctacatggccgcctctggccttaacgactcaacctacgacaaggcg
ggcaagacccacatcaaggcactggccgactttgccatgaagctgatggaccagatgaag
tacatcaatgagcactccttcaacaacttccagatgaagattgggctcaacatcggccct
gtggtggctggggtgattggggcacgaaagcctcagtacgacatctggggcaatacagtg
aacgtggctagccgcatggacagcactggtgtgcctgaccgcatccaggtcaccacggac
atgtaccagtgctggctgccaacacctaccagctggagtgccggggtgtggtcaaggtca
agggcaaaggcgagatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415141Help
Entry
100415141         CDS       T03264                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100415141 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100415141 (ADCY4)
   04371 Apelin signaling pathway
    100415141 (ADCY4)
   04020 Calcium signaling pathway
    100415141 (ADCY4)
   04072 Phospholipase D signaling pathway
    100415141 (ADCY4)
   04024 cAMP signaling pathway
    100415141 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100415141 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100415141 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100415141 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100415141 (ADCY4)
   04062 Chemokine signaling pathway
    100415141 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100415141 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100415141 (ADCY4)
   04912 GnRH signaling pathway
    100415141 (ADCY4)
   04913 Ovarian steroidogenesis
    100415141 (ADCY4)
   04915 Estrogen signaling pathway
    100415141 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100415141 (ADCY4)
   04921 Oxytocin signaling pathway
    100415141 (ADCY4)
   04926 Relaxin signaling pathway
    100415141 (ADCY4)
   04918 Thyroid hormone synthesis
    100415141 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100415141 (ADCY4)
   04916 Melanogenesis
    100415141 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100415141 (ADCY4)
   04927 Cortisol synthesis and secretion
    100415141 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100415141 (ADCY4)
   04270 Vascular smooth muscle contraction
    100415141 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100415141 (ADCY4)
   04971 Gastric acid secretion
    100415141 (ADCY4)
   04972 Pancreatic secretion
    100415141 (ADCY4)
   04976 Bile secretion
    100415141 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100415141 (ADCY4)
   04727 GABAergic synapse
    100415141 (ADCY4)
   04725 Cholinergic synapse
    100415141 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100415141 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100415141 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100415141 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100415141 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100415141 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100415141 (ADCY4)
   04714 Thermogenesis
    100415141 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415141 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100415141 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100415141 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100415141 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100415141 (ADCY4)
   05163 Human cytomegalovirus infection
    100415141 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100415141 (ADCY4)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100415141 (ADCY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180
Motif
Other DBs
NCBI-GeneID: 100415141
NCBI-ProteinID: XP_017832520
Ensembl: ENSCJAG00000006470
UniProt: F7GTG2
Position
10
AA seq 1077 aa AA seqDB search
MARLFSLRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELASDPS
FLTTVMCALGGFSLLLGLASREQRLQRWTRPLSGVVWAALLALGHAFLFTGGVVSAWDQV
SYFVFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVLGVYHKALMERALRATFREALSSLYSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTARGLLSSLEGSKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYEACTFLVFLSNFV
IQVLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCVLKGPKLLHWLPALSGLVATRP
GLRIALGTTTILLVFGTAITSLFFFPASSDCPFQALNVSSTTSNLSWELPGSLPLISVPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLITRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESDINREGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcttcagcctccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgcgcg
ctcgcggcactgctcgccgtggcctgggccagcggcagggagctggcctcagacccgagc
ttcctgaccactgtgatgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgacccctgtcgggcgtggtgtgggccgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctactttgtcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgagac
gccgccgtcgcgggcctcgcctcctcactctcccatctgctggtcctcgggctgtatctc
gggccacagccggactcacggcccgcactgctgccgcagttggcagcaaacgccgtgctg
tttctatgcgggaacgtgctgggagtgtaccataaggcgctgatggagcgcgccttgcgg
gccacgttccgggaggcactcagctccctgtactcgcgacggaggctggacacggagaag
aagcaccaggaacaccttcttttgtccatcctccctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacagggatcacggccagaaagcaccaacaat
ttccacagcctgtatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccgggctgccactctcactgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccaccggc
gtggacatcaacatgcgtgtgggtgtgcactcaggcagcgtactctgcggagtcatcggg
ctgcagaagtggcagtatgatgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggagagtgcatatcacaggggctaccctggcccttttggcaggg
gcttacgctgtggaggatgcaggcatggaacatcgggacccctaccttcgggagctaggg
gagcctacctacctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
cgaggcttgctgtcttcgcttgagggctccaagatgcgtccatcactgctgatgacccgc
tacctggaatcctggggcgcagccaagccttttgcccacctgagccatgtcgacagcccg
gtgtccacctccacccctctcccggagaaggccctggcttccttcagcccccagtggagc
ctggatcggagccgtactccccggggactagatgatgaactggacactggggatgccaag
tttttccaggtcattgagcagctcaactcgcagaaacaatggaagcagtcaaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
ctccctgccttcaaatactacgaagcctgcaccttcctggtttttctctccaacttcgtc
atccaggtgctagtgacaaacaggcccccagctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctaatgaggtgtgtcctg
aaaggccccaagctgctgcattggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcactaccaccattctccttgtctttggcacagccattacc
agcctgttcttcttccccgcatcatcagactgccctttccaagctctcaatgtgtcctcc
acgacttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcgttctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcctcctgctccctcttcctgcac
tcccatgcctggctgtctgactgcctcatcacccgcctctatctgggccccttggactcc
aggccaggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggatttcctgtgg
aagaagaagctgaggcaggagcgcgaggagacagagacgatggagaacctgactcggctg
ctcttggagaatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctacgaatgtgtttgtgtcctcttcgcctcagtcccg
gacttcaaggagttctactctgaatctgacatcaatcgtgagggcctagagtgtctgagg
ctgctcaatgaaataattgctgattttgatgagttgctctccaagcccaagttcagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctgggcaggatgcacaacaggatgctgagcggagctgcagccaccttggcactatggta
gagtttgccgtggccctggggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtggggttgaaccatgggccagtagtagctggagtgattggggcccag
aagccacaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagcaca
ggagtccttggcaaaatccaagtgactgaggagacagcctgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
tttctgaacacagacttgacacgaactggacctccttcagcaaccctaggctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415165Help
Entry
100415165         CDS       T03264                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04740  Olfactory transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100415165 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100415165 (ADCY3)
   04371 Apelin signaling pathway
    100415165 (ADCY3)
   04020 Calcium signaling pathway
    100415165 (ADCY3)
   04072 Phospholipase D signaling pathway
    100415165 (ADCY3)
   04024 cAMP signaling pathway
    100415165 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100415165 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100415165 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100415165 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100415165 (ADCY3)
   04062 Chemokine signaling pathway
    100415165 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100415165 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100415165 (ADCY3)
   04912 GnRH signaling pathway
    100415165 (ADCY3)
   04913 Ovarian steroidogenesis
    100415165 (ADCY3)
   04915 Estrogen signaling pathway
    100415165 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100415165 (ADCY3)
   04921 Oxytocin signaling pathway
    100415165 (ADCY3)
   04926 Relaxin signaling pathway
    100415165 (ADCY3)
   04918 Thyroid hormone synthesis
    100415165 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100415165 (ADCY3)
   04916 Melanogenesis
    100415165 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100415165 (ADCY3)
   04927 Cortisol synthesis and secretion
    100415165 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100415165 (ADCY3)
   04270 Vascular smooth muscle contraction
    100415165 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100415165 (ADCY3)
   04971 Gastric acid secretion
    100415165 (ADCY3)
   04972 Pancreatic secretion
    100415165 (ADCY3)
   04976 Bile secretion
    100415165 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100415165 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100415165 (ADCY3)
   04727 GABAergic synapse
    100415165 (ADCY3)
   04725 Cholinergic synapse
    100415165 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100415165 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100415165 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100415165 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100415165 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100415165 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100415165 (ADCY3)
   04714 Thermogenesis
    100415165 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415165 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100415165 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100415165 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100415165 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100415165 (ADCY3)
   05163 Human cytomegalovirus infection
    100415165 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100415165 (ADCY3)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100415165 (ADCY3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF3810 fn3_4 Peptidase_S49_N
Motif
Other DBs
NCBI-GeneID: 100415165
NCBI-ProteinID: XP_017819992
Ensembl: ENSCJAG00000008027
Position
14
AA seq 1145 aa AA seqDB search
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSNKLGPSRWLEIGLVLDIV
LFVLCKKGLLPDRVTRRVVPYLLWLLITAQIFSYLGLNFVGAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVLHMLVLGVTVAQQQQEELKEMQLLREILANVFLYLCAITVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCE
YLDEKGIETYLVIASKPEVKKTATQNGLNGLALPNGAPASSKPSSPALIETKEPNGSTHS
SGSMSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEILLLILTICSLAAIFPRAFPKKLVGFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYAGPSNTTAGMETEGRCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAAINLYAWRPIFDEYDRKRFREYDLPMVALEKMQGFTPGLNGTDSRLPLMPSK
YSMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGYASSNKEDKSDRERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPTTFPNGPPITLPHQ
VEDSS
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggagcctgagtactcggccgagtactcagccgagtac
tctgttagcctgccctccgaccctgaccgcggggtaggccggacccatgagatctctgtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccatgagaccctgctggtg
ctggtggtctttgcagccctttttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcaacaagctgggcccctcgcggtggctggaaattggactggtgttggacatcgtc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagggtagtgccc
tacctgttgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgta
ggtgcccatgcggccagtgacacggtgggctggcaggtcttcttcgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtttcctgtgtgttg
cacatgttggtactgggagtcactgtggcccagcagcagcaggaggagctgaaggagatg
cagctgctgcgggagatcctggccaatgtcttcctctacctgtgcgccatcaccgtgggc
atcatgtcctactacatggccgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggccgacgagatgttgaaagacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctctttgctgacattgtgggcttcactcagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgcttaacgagctctttgcccgcttcgacaagctggcagccaaataccaccag
ctgcggattaagatcctgggtgactgctactactgcatctgtggcctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgagagaagaccaagactggggtggacatgcgtgtgggggtacacacgggcactgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgacgtcacc
gtagccaacaagatggaggctggcggcatccctgggcgtgtgcacatctcccaaagcacc
atggactgcctaaagggagagtttgatgtggagccaggtgatgggggcagccgctgtgaa
tacctagatgagaagggcatcgaaacctacctcgtcattgcctccaagccagaggtgaag
aaaacagctacccagaatggtctcaatggcttggccctgcccaatggagcgccagcttcc
tcaaagcccagctcccctgccctcattgagaccaaggagcccaacgggagcacccacagc
agcggctccatgtcagagaagcctgaggagcaggatgctcaggccgacaacccctcattc
cccaacccacgtcggaggctgcgcctgcaggacctggctgaccgggtggtcgacgcctcc
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacacctttctcctgtccatgaggttcatggaccctgagatg
gaaacccgttactcggtggagaaggagaagcaaagtggggccgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtggagatactcatcgacccctggctaatgacaaac
tatgtgacctttgtggtgggggagattctgctcctcatcctgaccatctgctctctggct
gccatctttccccgggcctttcctaagaagcttgtgggtttctcgacttggattgaccgg
acccgctgggccagaaacacctgggccatgctagccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacgcgggacccagcaacacaacagcaggg
atggagacagaggggcgctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgcttgtcgcaggcgccgtggccgccatcaacctctatgcctggcgtcccatctttgat
gaatacgaccgcaagcgttttcgggagtatgacttacctatggtggccttagagaagatg
cagggattcacccctgggctcaacggcactgacagcaggctacccctgatgccttccaag
tactccatgacggtgatggtgttcctcatgatgctgagcttttactacttctcccgccac
gtagaaaaactggcacggacacttttcttgtggaaaattgaggtccatgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaggccttggtcaccaacatgctgcctgagcat
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgccgacttctacacagaggag
agcatcaacaatggtggcattgagtgtctgcgtttcctcaatgagatcatctcggatttt
gactctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagc
acgtatatggcagcctcaggagtcacccccgacgtcaacacgaatggctatgccagctcc
aacaaggaggacaagtccgatcgagagcgctggcagcacctggctgacctggccgacttc
gcactggccatgaaggatacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcattggagcccggaaacca
cactatgacatctggggcaatacagtcaatgtggccagcaggatggaatctacgggagtc
atgggtaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgc
tttgtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttg
aaggggcgggagaagcccaccaccttccctaacggcccccccatcacgctgccccaccag
gtggaggacagctcctga

DBGET integrated database retrieval system