KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385734
Entry
100385734         CDS       T03264                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100385734 (AKAP5)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100385734 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 100385734
NCBI-ProteinID: XP_009004401
Ensembl: ENSCJAG00000019569
UniProt: F7GXY9
Position
10
AA seq 426 aa
MATTVSEIHVENKDEKRSAEGSPQAERQEEKTSMLCFKRRKKAAKALKPKAGSEAADVTK
KCPQEAGASDQPEPPRGAWASLKHLVTRRKRLESSKQQKQLEAEVQPEINAEDAGLSKKK
AKSRLKIPCIKFQRGPKRRNHSKIIEDSVCSIKVQGEAENLDIQTQTPSSDQATKATSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDNGHSAIQMGTLILEEIETIKEKQ
DVQPQQASPLETSETDHEQPVLSDVTPLPAIPDQQIVEEASNNILESAPNGKDYESGETV
AEETKPKDTELSQEPDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVKKSKNVPK
QFLISTESEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDK
INNLLQ
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcaaccacagtttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctcaggctgaaagacaggaggaaaaaacatccatgctttgcttcaagagaaga
aagaaagcagctaaagcattgaagcccaaagctggctctgaagctgctgatgtaacaaag
aagtgtccccaagaagcaggagcttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacatcttgtaacacgaaggaaaaggttggagtcttcaaagcagcaaaagcaa
ttggaggctgaagtgcaacctgaaataaatgctgaggatgctggtctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattccaaagagggccaaaaaggaggaat
cattccaaaattatagaagactcagtctgcagcatcaaagtccagggagaggctgaaaat
ttggatatacaaacacagaccccatcaagcgatcaggcaacaaaggctacgtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaggtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttccgtagaacttggattagataatgggcat
tctgctattcaaatgggaactctaatccttgaagaaattgaaacaatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacttgaaacttcagaaacagaccatgagcaacca
gtactttctgatgttactcctttacctgcaatcccagatcaacaaattgtggaagaagcc
agtaacaatatcctagaaagtgcaccaaatgggaaagactatgaaagtggagaaactgta
gctgaagaaactaagccaaaagatactgaattgagccaagaaccagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaag
caattcttaatttcaacggaaagtgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgcgattcagttgtcaatagaacagctggttaatgaaatggcctctgatgataaa
ataaacaatcttctacagtga

DBGET integrated database retrieval system