KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385763Help
Entry
100385763         CDS       T03264                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100385763 (ITPR1)
   04020 Calcium signaling pathway
    100385763 (ITPR1)
   04070 Phosphatidylinositol signaling system
    100385763 (ITPR1)
   04022 cGMP-PKG signaling pathway
    100385763 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100385763 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100385763 (ITPR1)
   04210 Apoptosis
    100385763 (ITPR1)
   04218 Cellular senescence
    100385763 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100385763 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100385763 (ITPR1)
   04621 NOD-like receptor signaling pathway
    100385763 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    100385763 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100385763 (ITPR1)
   04912 GnRH signaling pathway
    100385763 (ITPR1)
   04915 Estrogen signaling pathway
    100385763 (ITPR1)
   04921 Oxytocin signaling pathway
    100385763 (ITPR1)
   04918 Thyroid hormone synthesis
    100385763 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100385763 (ITPR1)
   04924 Renin secretion
    100385763 (ITPR1)
   04925 Aldosterone synthesis and secretion
    100385763 (ITPR1)
   04927 Cortisol synthesis and secretion
    100385763 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100385763 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    100385763 (ITPR1)
   04971 Gastric acid secretion
    100385763 (ITPR1)
   04972 Pancreatic secretion
    100385763 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100385763 (ITPR1)
   04725 Cholinergic synapse
    100385763 (ITPR1)
   04728 Dopaminergic synapse
    100385763 (ITPR1)
   04726 Serotonergic synapse
    100385763 (ITPR1)
   04720 Long-term potentiation
    100385763 (ITPR1)
   04730 Long-term depression
    100385763 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    100385763 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100385763 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100385763 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100385763 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100385763 (ITPR1)
   05016 Huntington disease
    100385763 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100385763 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100385763 (ITPR1)
   05163 Human cytomegalovirus infection
    100385763 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100385763 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100385763 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100385763 (ITPR1)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100385763 (ITPR1)
Ion channels [BR:cjc04040]
 Ligand-gated channels
  IP3 receptor
   100385763 (ITPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 100385763
NCBI-ProteinID: XP_008980307
Ensembl: ENSCJAG00000015544
Position
15
AA seq 2757 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNKPQKHESTSSYNYRVVKEILIRLSKLCVQES
ASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQN
QALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKF
LQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPL
MYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV
DTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFS
SPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIP
VDLDSQVNNLFLKSHNIVQKTALNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALE
DRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLC
IKVLQTLREMMTKDRGYGEKQISIDELDNAELPPAPDSENVTEQELEPSPPLRQLEDHKR
GEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSVSRGEMSL
AEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKK
SERFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEV
RDQLLEASAATRKAFTTFRREADPDDHYQSGEGTQATADKTKDDLEMSAVITIMQPILRF
LQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVAL
INQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNA
SKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGASPRNVG
HNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVP
SICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNM
SFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGI
RALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFL
YHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVY
LFSIVGYLFFKDDFILEVDRLPNETTVPETGESLASEFLFSDMCRVETGENCSSPAPKEE
LVPAEETEEDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLF
FFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIK
EEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQN
ELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8274 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagtttcctacacattggagacatttgttctctgtacgcggag
ggatcgaccaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaataatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccagaagcagttctggaaagctgctaagcctggggcc
aacagcacaacagatgcggtgctgctcaacaaactgcaccacgctgcagacttggaaaag
aagcaaaatgagacagaaaacaggaaattgctggggactgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggctccctgct
ctgctggagaagaatgccatgagagtcacattggatgaggctggaaatgaagggtcctgg
ttttatattcagccattctataagctgcgatccatcggagacagcgtggtcataggtgac
aaggttgttctgaaccccgtcaatgctggtcagcccctccatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagatgacatattaaaggggggtgacgtggtg
aggctgttccatgctgaacaggagaaatttctcacctgtgacgaacacaggaagaagcag
catgtcttcctgagaaccacaggccggcagtcggccacatctgccactagttcaaaagcc
ctctgggaggtggaggtggtccaacatgacccgtgtcggggtggagcagggtattggaac
agccttttccgtttcaagcacctggccacagggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccttcagtagaccctgatcaggacgcctct
cgaagtaggttgcgaaatgcccaagaaaagatggtgtactccctggtctctgtgcccgaa
ggcaatgatatctcctccatttttgagctagaccccaccaccctccgcggaggcgacagc
cttgtaccaaggaactcttatgttcggctcagacacctgtgtactaatacctgggttcac
agcacaaatattcctattgacaaggaggaagaaaagcccgtgatgctgaaaattggcacc
tctcctgtgaaggaggacaaggaagcgtttgccatagttccagtttctcctgctgaagtt
cgggaccttgactttgccaatgatgccagcaaggtgctgggctccattgctgggaagctg
gagaagggcaccatcacccagaatgaaaggaggtctgtaaccaagctgctggaagacttg
gtttactttgtcactggaggaactaattctggtcaagatgttcttgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacaaaatattctcaagcagatcttc
aagttgttacaagccccattcacagactgcggtgatggcccaatgcttcggctagaggag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgctggccgaagacactattactgccctgctccac
aataatcggaaactcctagagaaacacattacggctgcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctctccgacctctgtgtctcc
atgaacaaatcgattccagtgacccaggaactgatatgtaaagctgtgctgaatcccacc
aacgctgacatcctgattgagaccaagttggttctttctcgttttgaatttgaaggtgtt
tcttccactggagagaatgctctggaggcaggagaagatgaggaagaggtgtggctgttt
tggagggacagcaacaaagagattcgcagcaagagtgtgagggagttggcgcaggatgct
aaagaaggccagaaggaggaccgggacgttctcagctactacagatatcagctgaacctc
tttgcgagaatgtgtctggaccgccaatacctggccatcaacgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgatgagaacctgccctacgacctcagggcg
tccttctgccgcctcatgcttcacatgcacgtggaccgagatccccaggaacaagtcact
cctgtgaaatatgcccgcctctggtcagagattccttcagagatcgccattgacgactat
gatagtagtggagcttccaaagatgaaattaaggagagatttgctcagaccatggagttt
gtggaggagtatttaagagatgtggtttgtcagaggttccctttctctgataaggagaaa
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggattgtgtacat
gtgactacaatcttccccattagcaagatggcgaaaggagaagagaataaaggtaacaat
gatgtggagaagctgaagagcagtaacgtgatgaggtctattcatggtgtgggagagctg
atgacccaggtggtgctccggggaggaggctttttgcccatgactcccatggctgctgcc
cctgaaggcaatgtgaagcaggcagagcctgagaaggaggacattatggtcatggacacc
aagctgaagatcattgagatcctccagtttattttgaatgtgaggttggattataggatc
tcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaattcccagacttcagag
acatcctccggaaacagcagccaagaagggccaagtaatgtaccaggtgctcttgacttt
gaacacattgaagagcaagcagaaggcatctttggaggaagcgaggagaacactccactg
gacttggacgatcacggtggcagaacctttctccgtgtcttgctccacctgacgatgcat
gactacccacccctggtgtcaggggccctgcagctcctctttcggcacttcagccagagg
caggaggtgctccaggccttcaaacaggttcaactgctggttaccagccaagatgtagac
aactataaacagatcaaacaagacttggatcagctgaggtccattgtggaaaagtcagag
ctttgggtgtacaaagggcagggccccgatgagaccatggatggtgcatctggcgaaaac
gaacataagaaaacagaggagggaaataagccacaaaagcatgaaagcaccagcagctac
aactacagagtggtcaaagagattttgattcggcttagcaaactctgtgttcaagagagt
gcctcggtgagaaagagcaggaagcagcaacagcgtctgctccgaaacatgggtgcgcac
gccgtggtgctggagctgctgcagattccctacgagaaggccgaagataccaagatgcag
gagataatgaggctggctcatgaatttttgcagaatttctgcgcaggcaaccagcagaat
caagctttgctacataaacacataaacctgtttctcaacccagggatcctggaggcagta
accatgcagcacatcttcatgaacaatttccagctttgcagtgagatcaatgagagagtc
gttcagcactttgttcactgcatagagactcacggtcggaacgtccagtatataaagttc
ttgcagacaattgtcaaggcagaagggaaatttattaaaaaatgccaagacatggttatg
gctgagctggtcaattcaggagaggatgtcctcgtgttctacaacgacagagcctctttc
cagactctcatccagatgatgcggtcagagcgggatcggatggatgagaacagccctctc
atgtaccacatccacttggtcgagctcctggctgtgtgcacggagggtaagaacgtctac
acagagatcaagtgcaactccctgctcccgctggatgacatcgttcgtgtggtgacccac
gaggactgtatacctgaggttaaaattgcatacattaacttcctgaatcactgctatgtg
gatacagaggtggaaatgaaggagatttataccagcaatcacatgtggaaattgtttgag
aatttccttgtagatatctgcagggcctgtaacaacactagtgacaggaaacatgctgac
tcgattttggagaagtatgtcaccgaaatcgtcatgagtattgttactactttcttcagc
tctccgttctcagaccagagtacgactttgcagactcgccagcctgtctttgtgcaactg
ctccaaggcgtgttcagggtgtaccactgcaactggttaatgccgagccaaaaagcctcc
gtggagagctgtattcgggtgctgtctgatgtagccaagagccgggccattgccattccc
gtggacctggacagccaagtcaacaacctctttctcaagtcccacaacattgtgcagaaa
acagccctgaactggcggctgtcagcccgcaatgctgcacgcagggactctgttctggca
gcttccagagactaccggaatatcattgagagattgcaggacatcgtctctgcgctggag
gaccgtctcaggcccctggtgcaggcagagttatctgtgctcgtggatgttctccacaga
cctgagctgcttttcccagagaacacagacgccagaaggaaatgtgaaagtggcggtttc
atttgcaagttaataaagcatacaaaacagctgctagaagaaaatgaggagaagctctgc
attaaggtcctacagaccctgagggaaatgatgaccaaagatagaggctatggagaaaag
cagatttccattgatgaattggataatgctgagcttcctccagctccggattctgagaac
gtcactgagcaggagcttgaaccaagtccacccctgcggcagctggaagaccataaaagg
ggtgaggcactcaggcaaattttggtcaaccgttactatggaaacatcagaccttctgga
agaagagagagccttaccagttttggcaatggcccgctgtcaccaggaggacccagcaag
cccgggggaggagggggaggttccggatccagctctgtgagcaggggtgagatgagcctg
gcggaggttcagtgtcaccttgacaaggagggggcttccaatctagtcatcgacctcatc
atgaatgcatccagtgaccgagtgtttcatgaaagcattctcctagccatcgcccttctg
gaaggaggcaacaccaccatccagcactcctttttctgccgattgacagaagataagaag
tcagagagattctttaaggtgttttatgaccggatgaaggtggcccagcaagaaatcaaa
gcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaagacgatgaggtagac
cgggatgcgccatcacggaaaaaagctaaagagcccacgacacagataacagaagaggtc
cgggatcagctgctggaggcctctgctgccaccaggaaagccttcaccaccttcaggagg
gaggctgaccccgatgaccactaccagtctggggagggcacccaggccactgccgacaaa
accaaggatgacctggagatgagcgcggtcatcaccatcatgcagcccatcctccgcttc
ctgcagctcctgtgcgaaaaccacaacagagacctgcagaacttcctccgttgccaaaat
aataagaccaactacaatttggtatgtgagaccctgcagtttctggactgtatttgtgga
agcacaactggaggccttggacttctgggcttgtatatcaatgaaaagaacgtggcactt
atcaaccaaaccctggaaagtctgacggaatactgtcaaggaccttgccatgagaaccag
aactgcatagccacccatgaatccaatggcattgacatcatcacagccctgatcctcaat
gatatcaatcctttgggaaagaagaggatggaccttgtgttagaactgaagaacaatgcc
tcgaagttgcttttggccatcatggaaagcaggcacgacagtgaaaacgcagagaggatc
ctttataacatgaggcccaaggaactggtggaagtgatcaagaaagcctacatgcaaggt
gaagtggaatttgaggatggagaaaatggtgaggatggagcatcccccaggaatgtgggg
cacaacatctacatattagctcatcagttggcccggcataacaaagaacttcagagcatg
ctgaaacctggtggccaagtggatggagatgaagccctggagttttatgccaagcacaca
gcacagatagagattgtcagattagaccgaacaatggaacagattgtctttcccgtgccc
agcatctgtgaattcctaaccaaggagtcaaaactacgaatttactacactacagagaga
gatgaacaaggcagcaaaatcaacgatttcttcctgcggtccgaagacctgttcaatgaa
atgaattggcagaagaaactgagagcccagcccgtgttgtactggtgtgcccgcaacatg
tctttctggagcagcatttcgtttaacctggctgtcctgatgaacctgctcgtggcgttt
ttctacccatttaagggcgtccgaggaggaaccctggagccccactggtcaggactcctg
tggacagccatgctcatctctctggccattgtcattgccctccccaagccccatggcatc
cgggctttaattgcctccacaattctacggttgatattttcagttggattacaacccaca
ttgtttcttctgggcgctttcaatgtatgcaataaaatcatctttctaatgagcttcgtg
ggcaactgtgggacattcacaagaggctaccgagccatggttctggatgttgagttcctc
tatcatttgctgtatctggtgatctgtgccatggggctctttgtccatgaattcttctac
agtctgctgctttttgatttagtgtacagagaagagactttacttaatgtcattaaaagt
gtcactcgcaatggacggtccatcatcctgacagcggttctggctctgatcctcgtttac
ctattctcaatagtgggctatcttttcttcaaggatgactttatcttggaagtagacagg
ctgcccaatgaaacaaccgttccagaaaccggcgagagtttggcaagtgagttcctgttc
tccgacatgtgtagggtggagactggggagaactgttcctctcctgcacccaaagaagag
ctggtccctgcagaagaaacggaagaggataaagagcacacatgtgagacactgctgatg
tgcattgtcactgtactgagtcacgggctgcggagcgggggtggagtaggagatgtgctc
aggaagccatccaaggaggaacccctgtttgctgctagagtgatttatgacctcttgttc
ttcttcatggttatcatcattgttcttaacctgatttttggggttatcattgacactttt
gctgacctgaggagtgaaaagcagaaaaaggaagagatcttaaagaccacatgctttatc
tgtggtttggaaagagacaagtttgacaacaagactgtcacctttgaagagcacatcaag
gaagaacacaacatgtggcactatctgtgctttatcgtcctggtgaaagtaaaggactcc
actgaatacaccgggcctgagagttatgtggcagaaatgatcaaggaaagaaaccttgac
tggttccccaggatgagagccatgtcattggtcagcagtgattctgaaggagaacagaat
gagctgaggaacctgcaggagaagctggagtccaccatgaaacttgtcacgaacctgtct
ggccagctgtcagaattaaaggatcagatgacagaacaaaggaagcagaaacaaagaatt
ggtcttctaggacatcctcctcacatgaatgtcaacccacaacaaccagcataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390843Help
Entry
100390843         CDS       T03264                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3-like
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04114  Oocyte meiosis
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100390843
   04020 Calcium signaling pathway
    100390843
   04070 Phosphatidylinositol signaling system
    100390843
   04022 cGMP-PKG signaling pathway
    100390843
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100390843
   04210 Apoptosis
    100390843
   04218 Cellular senescence
    100390843
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100390843
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100390843
   04621 NOD-like receptor signaling pathway
    100390843
   04625 C-type lectin receptor signaling pathway
    100390843
  09152 Endocrine system
   04911 Insulin secretion
    100390843
   04922 Glucagon signaling pathway
    100390843
   04912 GnRH signaling pathway
    100390843
   04915 Estrogen signaling pathway
    100390843
   04921 Oxytocin signaling pathway
    100390843
   04918 Thyroid hormone synthesis
    100390843
   04928 Parathyroid hormone synthesis, secretion and action
    100390843
   04924 Renin secretion
    100390843
   04925 Aldosterone synthesis and secretion
    100390843
   04927 Cortisol synthesis and secretion
    100390843
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100390843
  09154 Digestive system
   04970 Salivary secretion
    100390843
   04971 Gastric acid secretion
    100390843
   04972 Pancreatic secretion
    100390843
  09156 Nervous system
   04724 Glutamatergic synapse
    100390843
   04725 Cholinergic synapse
    100390843
   04728 Dopaminergic synapse
    100390843
   04726 Serotonergic synapse
    100390843
   04720 Long-term potentiation
    100390843
   04730 Long-term depression
    100390843
   04723 Retrograde endocannabinoid signaling
    100390843
  09157 Sensory system
   04742 Taste transduction
    100390843
   04750 Inflammatory mediator regulation of TRP channels
    100390843
  09159 Environmental adaptation
   04713 Circadian entrainment
    100390843
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100390843
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100390843
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100390843
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100390843
   05163 Human cytomegalovirus infection
    100390843
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100390843
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100390843
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100390843
Ion channels [BR:cjc04040]
 Ligand-gated channels
  IP3 receptor
   100390843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec MIR RIH_assoc RYDR_ITPR Ion_trans
Motif
Other DBs
NCBI-GeneID: 100390843
NCBI-ProteinID: XP_017826267
Ensembl: ENSCJAG00000012111
Position
4
AA seq 2436 aa AA seqDB search
MSEMFSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFRVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQVRPPALSYPPLSLPKRPNWCRARAASRQCPLRMCVSWGLSGPGASCVAVRLTVSMPV
AVMVVISMRAGHWNGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRAGRRNAG
EKIKYRLVAVPHGNDIASLFELDPTTLQKTDSLVPRNSYVRLRHLCTNTWIQSTNVPIDV
EEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLSEGFISQN
DRRFVIQLLEDLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQVRVHSGGDEA
GPGGQERDALNCRLSTPFNKNQYLPGTTPLSRTLLTVPGLRNPQEAQCPMPAAPWLPSAM
SSSSSLSCRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHLM
LHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDYL
NNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPAM
LQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGAPSLPTGASAAEPLDRSKFEENED
IVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTA
NMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFKH
FSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVEA
GAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMD
AHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLEA
ETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMI
MTELTNAGDDVVVFYNDKASLTHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNV
YTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTRXEMKEIYTSNHIWTLF
ENFTLDMSSGLSPWGVCSKREKRLPDPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQ
TIVVQLLQSTTRLLECPWLQQQHRGSVEACIRTLAMVAKGRAISLPMDLDAHISSMLSSG
ASCAAAVQRNTSSYKAAMRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELS
VLVDVLHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLK
KTKYGDRGNQLRKMLLQNYLQNRKSSSRGDLPDPIGTGLDQDWSAIAATQCRLDKEGATK
LVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKR
AQQETKSTVAVNMNDLGSQPHEDREPANPTTKGRMASFSMPASSSRYSLGPSLRRGHEVS
ERVQSNEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMC
GSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALIL
NDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQ
EEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQ
LSQMLKSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRL
FTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFI
NIIIAFFYPYVEGASTGVLDSPLISLLFWILICFSIAALFTKSYSIRPLIVALILRSIYY
LGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVGYILTSVLGLF
AHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDF
ILEVDRLPNNHSRASPLGMPHGAAAFVGTCSRDKMDCVSGVSVPEVLEEDGELDSTERAC
DTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGV
IIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLV
RVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKL
VSHLTAQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 7311 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgttcagctttctccacatcggggacatcgtctccctgtacgccgagggc
tctgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcagccggggacctggacaacccccctaagaagttccgagactgcctcttcagggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagattgccgacgtggtgttgctgcagaagctacagcatgccgcccagatggag
cagaagcaaaacgacacagagaacaagaaggtgcacggggatgtggtgaagtacggcagc
gtgatccaggtgaggccgcctgccctctcctacccacccctctccctgcctaagaggccg
aattggtgccgggcgagggctgccagtaggcagtgccctctgcgcatgtgtgtatcctgg
ggactgagtggccctggggccagctgtgtggctgttcgtctgactgtgtctatgcctgtt
gctgtcatggtggtcatcagcatgagagctgggcactggaatggcctgtaccgcttcaag
cacctagccacgggcaactacctggctgccgaggagaaccccagctacaaaggtgatgcc
tcggatcccaaggcagcaggaatgggggcccagggtcgtgcaggccgcaggaatgctggg
gagaagatcaagtaccgcctggtggccgtgcctcatggcaacgacatcgcctctctcttt
gagctggaccccaccacattgcagaaaaccgactctttggtgccccggaactcctacgtc
cggctgcggcacctctgcaccaacacatggatccagagcaccaacgtgcccattgacgtt
gaggaggagcggcccatccggctcatgctgggcacctgccccaccaaggaggacaaggag
gcctttgccattgtgtcggtgcccgtgtccgagatccgagacctggactttgctaatgac
gccagctccatgctggctagtgccgtggagaaactcagtgagggcttcatcagtcagaat
gaccgcaggtttgtcatccagctacttgaagacctggtgttctttgtcagcgatgtcccc
aacaatgggcagaatgtcctggacatcatggtcaccaagcccaaccgggaacggcagaag
ctgatgagggagcagaacatcctcaaacaggtgcgtgtgcactcaggaggggacgaggcg
gggccgggtggccaggagcgggatgccttgaactgccggctcagcactcccttcaacaaa
aatcagtatttaccgggcacgaccccactaagcagaaccctgctaactgtgccagggtta
cgaaatcctcaggaagcccagtgcccaatgccagcagccccctggctgccatctgccatg
tcctcatcgtcctccctgtcctgcaggtaccagctgaagctctttgctcgcatgtgcttg
gatcgccagtacttggccatcgatgagatctcccagcagctgggcgtggacctgatcttc
ctgtgcatggcggatgagatgctgcccttcgacctgcgtgcctccttctgccacctgatg
ctgcacgtgcatgtggaccgcgacccccaggagctggtcacgcccgtcaagttcgcccgt
ctctggactgagatccccacagccatcaccatcaaggactatgattctaatctcaatgcg
tcccgagatgacaagaagaacaagtttgccagcaccatggagttcgtggaggactacctc
aacaatgtggtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcactttt
gaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgagctg
ctgaggctcactcgcacgctgctgggcatcatcgactgtgtgcaggggcccccggccatg
ctgcaggcctacgaggaccccggcggcaagaatgtgcggcgttccatccagggcgtgggg
cacatgatgtccaccatggtgctgagccgcaagcagtccgtcttcggtgcccccagcttg
cctaccggggccagtgctgcggagccactggacagaagcaagtttgaggagaatgaggac
attgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctgaatgtc
cgcctggattaccgcatctcctatctgctgtctgtattcaagaaggagtttgtggaggtg
tttcccatgcaggatagcggggctgatggcacagcccctgccttcgactctaccactgcc
aacatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtgggaaagacg
agcagcatgctggaggtggacgacgagggcggccgcatgttcctgcgtgtgctcatccac
ctcactatgcacgactatgcgccactggtctcgggtgccctgcagctgctcttcaagcac
ttcagccagcgccaggaggccatgcacaccttcaagcaggtgcagctgctgatctcggct
caggacgtggagaactacaaggtgatcaaatcggagctggaccggctgcggaccatggtg
gagaagtcggagctgtgggtggacaagaagggcagcggcaaaggtgaagaggtggaggca
ggtgccgccaaggacaagaaggagcggcccacagatgaggagggttttctgcacccgcca
ggggagaagagcagtgagaactaccagatcgtcaagggcatcctggaacggctgaacaag
atgtgtggggtcggagagcagatgcggaagaagcagcagcggctgctgaagaacatggat
gcccacaaggtcatgctggacctgctgcagattccctacgacaagggtgatgccaagatg
atggagatcctgcgttacacgcaccagttcctgcagaagttctgtgcggggaaccccggc
aaccaggccctgctacacaagcacctgcacctcttcctcacaccagggctcctggaggca
gagaccatgcaacacatcttcctgaacaactatcagctctgctccgagatcagcgagcct
gtgttgcagcacttcgtgcacctgctggccacgcacgggcgccacgtgcagtacctggac
ttcctgcacactgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatgatc
atgactgagctgaccaacgcaggtgacgatgtggtcgtgttctacaatgataaggcatcg
ctgacccacctgctggacatgatgaaggccgctcgcgatggcgtggaggaccacagcccc
ctcatgtaccacatttccctggtggacctgctggctgcctgcgccgagggcaagaacgtc
tacactgagatcaagtgcacctccctgctgccactggaggacgtggtgtctgtggtgaca
catgaggactgcatcaccgaggtgaaaatggcctatgtgaactttgtgaaccactgctac
gtggacacgaggnntgagatgaaggagatctacaccagcaaccacatctggacgctcttt
gagaacttcaccctggacatgagctcgggtctgtccccgtggggggtctgcagcaagcgt
gagaagcgcctgcctgaccccaccctggaaaaatacgtgctgagcgtcgtactggacacc
attaacgcgttcttcagctccccgttctccgagaacagcacttccctgcagacgcaccag
acgattgtggtgcagctactacagtccaccacacggctccttgagtgtccgtggctacag
cagcagcacaggggctctgtggaggcctgcatccggaccctcgccatggtggccaagggc
cgggccatctcgctgcccatggacctggatgcccacatcagctcaatgctcagcagtgga
gccagctgtgcagctgccgtccagcggaacacctccagctacaaggcagccatgagggcc
tttccccgagtcacccccactgccaaccagtgggactataagaacatcatcgagaagctg
caggacatcatcacagccttggaggagcggctgaagcccctggtacaggctgagctgtct
gtgctggtcgacgtcctgcactggcctgagctgctcttcctggagggcagtgaggcctat
cagcgctgcgagagtgggggctttctgtccaagttgatccagcacaccaaggacctgatg
gagtcggaggagaagctgtgcatcaaggtcctgcggaccctgcagcagatgctgctcaag
aagaccaagtacggggaccggggcaaccagcttcgcaagatgctgctgcaaaactacctc
cagaaccgcaagtccagctctcggggggaccttcccgaccccatcggcactggcctggac
caagactggtcagcaattgcagccacccagtgccggctggacaaggagggggccaccaag
ctggtatgtgacctcatcaccagcaccaagaatgagaagatcttccaggagagcatcggc
ctggccatccgcctgctggatggtggcaacacggagatccagaaatccttccacaacctg
atgatgagtgacaagaagtctgagcgcttcttcaaggtgctgcatgaccgcatgaagcgg
gctcaacaggagaccaagtccacggtggcagtcaacatgaatgacttgggcagccagccg
catgaggaccgcgagccagccaaccccaccaccaaaggccgcatggcctctttctcgatg
ccagcttcctcatcccgctactcgctgggccccagcctgcgccgggggcacgaggtgagc
gagcgtgtgcagagcaacgagatgggcacgtccgtgctcatcatgcagcccatcctgcgc
tttctgcagctgctgtgcgagaaccacaaccgggacctgcagaacttcctgcgctgtcag
aacaacaaaaccaactacaacttggtgtgcgagacgctgcagttcctggacatcatgtgc
ggcagcaccacgggcggcctggggctgctggggctctacatcaatgaggacaatgtgggc
ctcgtcatccagaccttggagaccctcactgagtactgccagggcccctgccatgagaac
cagacctgcatcgtgacgcacgagtccaacggcatagacatcatcaccgccctgatcctc
aatgacatcagcccgctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaat
gcctccaagctgctcctggctctgatggagagccggcacgacagtgaaaacgctgagcgc
atcctcatcagcctgcggccccaggagctggtggacgtcatcaagaaggcctacctgcag
gaagaagagcgtgagaattcagaggtgagcccacgtgaagtgggccataacatctacatc
ctggcactgcagctctccaggcacaataaacagctgcagcacctgctgaagcccgtgaag
cgcattcaagaggaggaggccgagggtatctcttccatgctcagcctcaacaacaagcaa
ctgtcacagatgctcaagtcctcagtgccagcacaggaggaggaggaagaccccctggcc
tactacgagaaccacacgtcccagatcgagattgtgcggcaggaccgcagcatggagcag
atcgtgttcccggtgcctggcatctgccagttcctgacggaagagaccaagcaccggctc
ttcaccactaccgagcaggacgagcagggcagcaaagtgagcgacttctttgaccagtcc
tcctttctgcacaacgagatggagtggcagcgaaagctccgcagcatgccactgatctac
tggttctcccgccgcatgaccctgtggggcagcatctccttcaacctggctgtgtttatc
aacatcatcattgccttcttctacccttatgtggagggtgcatccacaggcgtgctggat
tcccctctcatctcactgctgttctggatcctcatctgcttctccattgctgccctgttc
accaagagctacagtattcgccccctcatcgtggcactcatcctgcgctccatctactat
ctgggcatcgggcccacgctcaacattctgggtgccctcaacctgaccaacaagatcgtg
tttgtggtgagcttcgtgggcaaccgtggcaccttcatccggggctataaggccatggtc
atggacgtggaattcctctaccacgtgggctacatcctgactagtgtcctgggcctcttt
gctcacgagctgttctacagcatcctgctctttgacctcatctaccgcgaggagacgctg
ttcaacgtcatcaagagcgtgacccgcaatggccgctccatcctgctgacagccctgctg
gccctcatcctggtctacctcttctccattgtcggcttcctcttcctcaaggatgacttc
atcctcgaggtcgaccggctgcccaacaaccactccagagccagccccttggggatgcca
cacggagctgctgcatttgtgggcacttgcagcagggacaagatggactgtgtctcaggg
gtctcggtgcccgaggtcctagaagaggacggagagctggacagcacagagcgggcctgt
gacactctgctgatgtgcatcgtcaccgtcatgaaccatgggctacgcaacggtggtggc
gtgggcgacattctccgaaagccctcgaaagacgagtctctgttcccagcccgagtggtc
tatgacctcctgttcttcttcatcgtcattatcatcgtgctgaacctcatctttggggta
atcattgacaccttcgctgacctgcgcagtgagaagcagaagaaggaggagattctcaag
acgacatgcttcatctgtggtctggagagggacaagtttgataacaagacagtgtcattt
gaggaacacatcaagctggagcacaacatgtggaactacctgtacttcatcgtgctggtt
cgcgtgaagaacaagacggactacacaggccctgagagctacgtggcccagatgatcaag
aacaagaacctggactggttcccccggatgcgggccatgtcccttgtgagcaatgagggt
gaaggggagcagaatgagattcggattcttcaggacaagctcaactccaccatgaagctg
gtgtcccacctcactgcccagctcaacgagctcaaggagcagatgacggagcagcggaaa
cgcaggcaacgcctaggctttgtggatgtccagaactgcatgagccgctga

DBGET integrated database retrieval system