KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385800Help
Entry
100385800         CDS       T03264                                 

Gene name
CD40, TNFRSF5
Definition
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04620  Toll-like receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05202  Transcriptional misregulation in cancer
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05322  Systemic lupus erythematosus
cjc05330  Allograft rejection
cjc05340  Primary immunodeficiency
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100385800 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100385800 (CD40)
   04514 Cell adhesion molecules (CAMs)
    100385800 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100385800 (CD40)
   04672 Intestinal immune network for IgA production
    100385800 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100385800 (CD40)
  09163 Immune disease
   05310 Asthma
    100385800 (CD40)
   05322 Systemic lupus erythematosus
    100385800 (CD40)
   05320 Autoimmune thyroid disease
    100385800 (CD40)
   05330 Allograft rejection
    100385800 (CD40)
   05340 Primary immunodeficiency
    100385800 (CD40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100385800 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100385800 (CD40)
   05169 Epstein-Barr virus infection
    100385800 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    100385800 (CD40)
   05145 Toxoplasmosis
    100385800 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100385800 (CD40)
   04090 CD molecules [BR:cjc04090]
    100385800 (CD40)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100385800 (CD40)
CD molecules [BR:cjc04090]
 Proteins
  100385800 (CD40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 TMEM154
Motif
Other DBs
NCBI-GeneID: 100385800
NCBI-ProteinID: NP_001254659
Ensembl: ENSCJAG00000017119
UniProt: Q3LRP1 U3C9Y9
Position
5
AA seq 274 aa AA seqDB search
MFRLPLQCVLWGCLLSSVHPEPPTACREKQYLINSQCCSLCQPGWKLVNDCTEVTETECL
PCGKGEFLDTWNRETHCHQHKYCDPNLGLRVQQEGTSVTDNICVCKEGRHCTSKACESCV
LYHSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTRCETKGLAEQQAGTD
KTDAVCGPQNRLRLLVVIPIMLGILFAILLVLVFIKKVDRKPQDKAPCTKQIPQEIDDLP
GPNPTPPVQETLHGCQPVAQEDGKESRISVQERQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtctgcctctgcagtgtgtcctctggggctgcttgctgtcctctgtccatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccaaccaggatggaaactggtgaatgactgcacagaggtcactgaaacggaatgcctt
ccttgcggcaaaggcgaattcctagacacttggaacagagagacacactgccaccagcac
aaatactgtgaccccaacctagggcttcgggtccagcaggagggcacttcagtaacagac
aacatctgcgtctgtaaagaaggccgacactgtacaagcaaggcctgcgagagctgtgtc
ctgtaccattcatgctcacctggctttggggtcaagcagatcgctacaggagtttctgac
accatctgcgagccctgcccagttggcttcttctctaatgtgtcatctgcttttgaaaaa
tgtcgcccttggacaaggtgtgagaccaaaggcctggctgagcaacaggcaggaacagac
aagactgatgctgtctgtggtccccagaatcggctgagactcctggtggtgatccccatc
atgttggggatcctgtttgccatcctcctggtgctggtctttatcaaaaaggtggacagg
aagccacaggataaggccccctgcaccaagcagattccccaggagatagacgatcttcct
ggccccaaccctacccctccagtgcaggagactttacatggatgtcaaccagttgcccag
gaggatggtaaagagagtcgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system