KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385889Help
Entry
100385889         CDS       T03264                                 

Gene name
MCM2
Definition
(RefSeq) minichromosome maintenance complex component 2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100385889 (MCM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100385889 (MCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100385889 (MCM2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100385889 (MCM2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100385889 (MCM2)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100385889 (MCM2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100385889 (MCM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_3 AAA_5 AAA_lid_2 DUF445 AAA AAA_2 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 100385889
NCBI-ProteinID: XP_008980513
Ensembl: ENSCJAG00000008943
UniProt: U3APR1
Position
15
AA seq 904 aa AA seqDB search
MAESSESFIVASSPARRRRGNDPLTSSPGRSSRRIDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDTYEAEGLALDDEDVEELTASQREAAERAMRQR
DREASRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDSEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPVELLQIFDEAALEVVLAMYPKYDRITSHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFILGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKIITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLVNGSTSEPTMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatcatcggagtccttcatcgtggcatccagcccggctaggcgtcggcgaggc
aatgatcctctcacctccagccctggccggagctcccgacgcattgatgccctgacctcc
agccctggccgtgaccttccaccctttgaggatgagtctgaggggctcctaggcacagag
gggcccctggaggaagaagaggatggagaggagctcattggagatggcatggagagggat
taccgtgccattccagagctggacacttacgaggctgagggactggctctggacgatgag
gatgtagaggagctgacggccagccagagggaggccgcagagcgggccatgcgacagcgt
gaccgagaggccagccggggcttgggccgcatgcgccgtgggcttctatatgatagcgat
gaggaggacgaggagcgccctgcccgcaagcgccgccaggttgagcgggccacggaggac
agcgaggaggacgaggagatgatcgagagcattgagaacctggaggacctcaagggccac
tctgtgcgcgagtgggtgagcatggcgggcccccggctggagatccaccaccgcttcaag
aacttcctacgcactcatgtggacagccacggccacaacgtcttcaaggagcgcatcagc
gacatgtgcaaagagaaccgtgagagcctggtggtgaactatgaggacctggcggccagg
gagcatgtgttggcctacttcctgcctgaggcgccagtggagctgctgcagatctttgat
gaggctgccctggaggtggtattggccatgtaccccaagtatgaccgtatcaccagccac
atccacgtccgcatctctcacctgcctctggtggaagagctgcgctcactgagacagctg
cacctgaaccagctgattcgcaccagtggggtggtgaccagctgcactggcgtcctgccc
cagctcagcatggtcaagtacaactgcaacaagtgcaatttcatcctggggcctttctgc
cagtcccagaaccaggaggtgaaaccaggctcctgtcctgagtgccagtcggctggtccc
tttgaggttaacatggaagagaccatctatcagaactaccagcgtatccgaatccaggag
agtccaggcaaagtggcggctggccggctgccccgctccaaggatgccattctccttgca
gatctggtggacagctgcaagccaggagacgaaatagagctgactggtatctatcacaac
aactatgatggctcccttaacactgccaatggcttccccgtctttgctactgtcatcttg
gccaaccatgtggccaagaaggacaacaaggtcgctgtaggggaactgactgatgaagat
gtgaagatcatcactagcctctccaaggatcagcagatcggggaaaagatctttgccagc
attgctccttccatctacgggcatgaagacatcaagagaggcctggctctggccctgttt
ggaggggagcccaaaaacccaggtggcaaacacaaggtacgaggtgatatcaatgtgctc
ttgtgtggagaccctggcacggcgaagtcacagtttctcaagtatatcgagaaagtgtcc
agccgagccatcttcaccaccggccagggggcgtcggctgtgggcctcacggcatatgtc
cagcggcaccctgtcagcagggagtggaccttggaggctggggccctcgttctggctgac
cgaggagtgtgtctcatcgatgaatttgacaagatgaatgaccaggacagaactagcatc
cacgaggccatggagcaacagagcatctccatctcaaaggctggcatcgtcacctccctc
caggctcgctgcaccgttattgctgccgccaaccccataggaggccgctacgacccctca
ctaaccttctccgagaacgtggacctcacagagcccatcatctcacgcttcgacatcctg
tgtgtggtgagggacactgtggacccagtccaggacgagatgctggcccgcttcgtagtg
ggcagccatgtcagacaccaccccagcaacaaggaggaggaagggctggtcaatggcagc
acctctgagcccaccatgcccaatacgtatggcgtggaacctctgccccaggaggttctg
aagaagtacatcatctatgccaaggagagggttcatccaaagctcaatcagatggaccag
gacaaggtggccaagatgtacagtgacctgaggaaagagtctatggcaacaggcagcatc
cccatcacagtgcggcacatcgagtccatgatccgcatggcagaggcccacgcacgcatc
catctgcgggactatgtaatagaagacgatgtcaacatggccatccgcgtgatgctggaa
agcttcatcgacacgcagaagtttagcgtcatgcgcagcatgcgcaagacttttgcccgc
tacctttcattccggcgtgacaacaatgagctgttgctcttcatactgaagcagttagtg
gcagagcaggtgacgtatcagcgcaaccgctttggggcccagcaggacactattgaggtc
cctgagaaggacttggtggataaggctcgtcagatcaacatccacaacctctctgcattt
tatgatagtgagctcttcaggatgaataagttcagccacgacctgaaaaggaagatgatt
ctgcagcagttctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393780Help
Entry
100393780         CDS       T03264                                 

Definition
(RefSeq) DNA replication licensing factor MCM5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100393780
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100393780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100393780
   03036 Chromosome and associated proteins [BR:cjc03036]
    100393780
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100393780
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100393780
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100393780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_lid MCM_OB Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 100393780
NCBI-ProteinID: XP_017824683
Position
Un
AA seq 494 aa AA seqDB search
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTSSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRGLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAILKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcccagacacatgcagctgtactgcgacaggtacctgtgtgacaaggttgtccctggg
aacagggttaccatcatgggcatctactccatcaagaagtttggcctgacctccagcagg
ggccgtgacagggtgggcgtgggcatccgaagttcctatatccgtgtcctgggcatccag
gtggacacagatggctctggccgcagctttgctggggccgtgagcccgcaggaggaggag
gagttccgtggtctggccgccctccccaatgtctatgaggtcatctccaagagcatcgcc
ccctccatttttgggggcacggatatgaagaaggccattgcctgcctgctctttggggga
tcccgaaagaggctccctgatggacttactcgccgaggagacatcaacctgctgatgcta
ggggaccctgggacagccaagtcccagcttctgaagtttgtggagaagtgttctcccatt
ggggtttacacgtctgggaaagggagcagtgcagccggactgacagcctcggtgatgagg
gacccttcgtcccggaatttcatcatggaaggtggagccatggtcctggctgatggtggg
gtcgtctgtattgatgagtttgacaagatgcgagaagacgaccgtgtggcaatccatgaa
gccatggagcagcagaccatctctattgccaaggctgggatcaccaccaccctgaactct
cgctgctccgtcctggctgctgccaactcagtgtttggccgctgggatgagacgaagggg
gaggacaacattgatttcatgcctaccatcttgtcgcgcttcgatatgatcttcattgtc
aaggatgagcacaatgaggagagggatgtgatgctggccaagcatgtcattactctgcac
gtaagtgcactgacacagacacaggccgtggagggcgagatcgacctggccaagctgaag
aagtttattgcctactgccgagcgaggtgcggcccccggctgtcagcagaggccgcagag
aagctgaagaaccgctacatcatcatgcggagcggggcccgtcagcacgagagggacagt
gaccgccgctccagcatccccatcactgtgcggcagctggaggccattgtgcgaatcgct
gaagccctcagcaagatgaagctgcagcccttcgccacagaggcagatgtggaggaggcc
ctgcggctcttccaagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtg
gagggcttcaccagccaggaggaccaggagatgctgagccgcatcgagaagcagctcaag
cgccgctttgccattggctcccaggtgtctgagcacagcattatcaaggacttcaccaag
cagaaatacccggaacatgccatcctcaaggtgctgcagctcatgctgcggcggggcgag
atccagcatcgcatgcagcgcaaagttctctaccgcctcaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395555Help
Entry
100395555         CDS       T03264                                 

Definition
(RefSeq) DNA replication licensing factor MCM3-like
  KO
K02541  DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100395555
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100395555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100395555
   03036 Chromosome and associated proteins [BR:cjc03036]
    100395555
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100395555
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100395555
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100395555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 100395555
NCBI-ProteinID: XP_008984146
Position
20
AA seq 762 aa AA seqDB search
MWSCGRPREITWTSWMMRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSF
GSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLE
AFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDIILDDDLV
DKVKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVEQMSKDAQPSFSAEDIAKIKK
FSKTRSKDIFDLLARSLAPSIHGHDYVKKAILCLLLEGVERDLENGSHIRGDINILLIGD
PSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGECRLEAGAMVLADRGVV
CIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNASCSVLAAANPVYGRYDQYKTPM
ENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHHYRAPGEQDGDAMPLGSAVDI
LATDDPNFSQDDQQDTQIYEKHDNLLHGTKKKKEKMVNAAFMKKYIHMAKIIKPVLTQES
AAYIAEEYSRLRSQDSMSSDTTRTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAV
ELVQYAYFKKVLEKEKKRKKRSEDESETEDEEGKSQEDREQKRKRRKTSQPDAKDGDSYD
PYDFSDTEEEMPQVHTPKTADSQETKESQKVELSETRLKAFKVALLDVFREAHAQSVGVN
RLTESINRDSKEPFSSVEIQAALSKMQDDNQVMVSEGIVFLI
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctgcgggaggcccagagagattacctggacttcctggatgatgaggctcctg
aacaatgcctttgaggagctggttgccttccagcgggccttaaaggattttgtggcttcc
attgatgctacctatgcgaagcagtatgaggagttctacataggattggagggcagcttt
ggctccaagcacgtctccccgcggactcttacctcttgtttcctcagctgtgtggtctgt
gtggagggcatcgtcactaaatgttctctagttcgtcccaaagtcgtccgcagtgtccac
tactgtcctgctactaagaagaccatagaacgacgttactctgatctcaccaccctggag
gcctttccctccagctctgtctatcccaccaaggatgaggagaacaatccccttgagaca
gaatatggcctgtctgtttacaaggatcaccagaccatcaccatccaggagatgccggag
aaggccccagccggccagctcccccgctctgtggatatcattctggatgatgacttggtg
gataaagtgaagcctggtgaccgagttcaggtggtgggaacctaccgttgccttcctgga
aagaagggaggctatacctctgggaccttcaggactgtcctgattgcctgtaatgtggag
cagatgagcaaggacgctcagccttctttctctgctgaggatatagccaagatcaagaag
ttcagtaaaacccgatccaaggatatctttgacctgctggccaggtcattggcccctagt
atccatgggcatgactatgtcaagaaagcaatcctctgcttgctcttggaaggcgtggaa
cgagacctagaaaatggcagccacatccgtggggacatcaatattcttctaataggagac
ccatcggttgccaagtctcagcttctgcggtacgtgctttgcactgcaccccgggctatc
cccaccactggccggggctcctctggagtgggtctgacagctgctgtcaccacagaccag
gaaacaggggagtgccgtctagaagcgggggccatggtcctggctgaccgaggcgtggtt
tgcattgatgaatttgacaaaatgtctgacatggatcgcacagccatccatgaagtgatg
gagcagggtcgagtgaccatcgccaaggctggcatccatgctcggctgaatgccagctgc
agtgttttggcagctgccaaccctgtctacggcaggtatgaccagtataagactccaatg
gagaacattggactacaggactcactgctgtctcgatttgacttgctcttcattatgctg
gatcagatggatcctgagcaggatcgggagatatcggaccatgtccttcggatgcaccat
tacagagcacctggggagcaggatggcgatgctatgcccttgggtagtgctgtggatatc
ctggccacagatgatcccaactttagccaggatgatcagcaggacacccagatttatgag
aagcatgataaccttctgcatgggaccaagaagaaaaaggagaagatggtgaatgcagca
ttcatgaagaagtacatccatatggccaaaatcatcaagcctgtcctgacacaggagtca
gctgcctacattgcagaagagtattcacgcctgcgcagccaggatagcatgagctcggac
accaccaggacatctccagttacagcccgaacactggaaactctgattcgacttgccaca
gcccatgcaaaggcccgcatgagcaagactgtggacctgcaggatgcagaggaagctgtg
gagttggtccagtatgcttacttcaagaaggttctggagaaagagaagaaacgtaagaag
cgaagtgaggatgaatcagagacagaagatgaagaggggaaaagccaagaggaccgagag
cagaagaggaagagaaggaagactagccagccagatgccaaagatggggattcatatgac
ccctatgacttcagtgacacagaggaggagatgcctcaagtacacactccaaagacggcc
gactcgcaggagaccaaggaatcccagaaagtggagttgagtgaaaccaggttgaaggca
ttcaaggtggctctcttggatgtgttccgggaagctcatgcgcagtcagtcggcgtgaat
cgcctcacagaatccatcaaccgcgacagcaaagagcccttctcttcagttgagatccag
gctgctctgagcaagatgcaggatgacaatcaggtcatggtgtctgagggcatcgtcttc
ctcatctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398450Help
Entry
100398450         CDS       T03264                                 

Gene name
MCM3
Definition
(RefSeq) minichromosome maintenance complex component 3
  KO
K02541  DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100398450 (MCM3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100398450 (MCM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100398450 (MCM3)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398450 (MCM3)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100398450 (MCM3)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100398450 (MCM3)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100398450 (MCM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 100398450
NCBI-ProteinID: XP_002746688
Ensembl: ENSCJAG00000011389
UniProt: F7G835
Position
4
AA seq 808 aa AA seqDB search
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISENQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSIYKDHQTVTIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRVQVVGT
YRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
RSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQDDQQ
DTQIYEKHDNLLHGTKKKKEKMVNAAFMKKYIHVAKIIKPVLTQESAAYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKRSEDESETEDEEGKSQEDREQKRKRRKTSQPDAKDGDSYDPYDFSDTEEEMPQV
HTPKTADSQETKESQKVELSETRLKAFKVALLDVFREAHAQSVGVNRLTESINRDSEEPF
SSVEIQAALSKMQDDNQVMVSEGIVFLI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaccgtggtgctggacgatgtggagctgcgggaggcccagagagattacctg
gacttcctggatgatgaggaagaccagggaatttatcagagcaaagttcgggagctgatc
agtgagaaccaataccggctgattgtcaatgtgaatgacctgcgcaggaaaaacgagaag
agggctaaccggctcctgaacaatgcctttgaggagctggttgccttccagcgggcctta
aaggattttgtggcttccattgatgctacctatgcgaagcagtatgaggagttctacata
ggattggagggcagctttggctccaagcacgtctccccgcggactcttacctcttgtttc
ctcagctgtgtggtctgtgtggagggcattgtcactaaatgttctctagttcgtcccaaa
gtcgtccgcagtgtccactactgtcctgctactaagaagaccatagaacgacgttactct
gatctcaccaccctggtggcctttccctccagctctgtctatcccactaaggatgaggag
aacaatccccttgagacagaatatggcctgtctatttacaaggatcaccagaccgtcacc
atccaggagatgccagagaaggccccagccggccagctcccccgctctgtggatgtcatt
ctggatgatgacttggtggataaagtgaagcctggtgaccgagttcaggtggtgggaacc
taccgttgccttcctggaaagaagggaggctatacctctgggaccttcaggactgtcctg
attgcctgtaatgtgaagcagatgagcaaggacgctcagccttctttctctgctgaggat
atagccaagatcaagaagttcagtaaaacccgatccaaggatatctttgaccagctggcc
aggtcattggcccctagtatccatgggcatgactatgtcaagaaagcaatcctctgcttg
ctcttgggaggggtggaacgagacctagaaaatggcagccacatccgtggggacatcaat
attcttctaataggagacccatcggttgccaagtctcagcttctgcggtacgtgctttgc
actgcaccccgggctatccccaccactggccggggctcctctggagtgggtctgacagct
gctgtcaccacagaccaggaaacaggggagcgccgtctagaagcgggggccatggtcctg
gctgaccgaggcgtggtttgcattgatgaatttgacaaaatgtctgacatggatcgcaca
gccatccatgaagtgatggagcagggtcgagtgaccatcgccaaggctggcatccatgct
cggttgaatgcccgctgcagtgttttggcagctgccaaccctgtctacggcaggtatgac
cagtataagactccaatggagaacattggactacaggactcactgctgtctcgatttgac
ttgctcttcattatgctggatcagatggatcctgagcaggatcgggagatatcggaccat
gtccttcggatgcaccgttacagagcacctggggagcaggatggcgatgctatgcccttg
ggtagtgctgtggatatcctggccacagatgatcccaactttagccaggatgatcagcag
gacacccagatttatgagaagcatgacaaccttctgcatgggaccaagaagaaaaaggag
aagatggtgaatgcagcattcatgaagaagtacatccatgtggccaaaatcatcaagcct
gtcctgacacaggagtcagctgcctacattgcagaagagtattcacgcctgcgcagccag
gatagcatgagctcggacaccgccaggacatctccagttacagcccgaacactggaaact
ctgattcgacttgccacagcccatgcaaaggcccgcatgagcaagactgtggacctgcag
gatgcagaggaagctgtggagttggtccagtatgcttacttcaagaaggttctggagaaa
gagaagaaacgtaagaagcgaagtgaggacgaatcagagacagaagatgaagaggggaaa
agccaagaggaccgagagcagaagaggaagagaaggaagactagccagccagatgccaaa
gatggggattcatatgacccctatgacttcagtgacacagaggaggagatgcctcaagta
cacactccaaagacggctgactcgcaggagaccaaggaatcccagaaagtggagttgagt
gaaaccaggttgaaggcattcaaggtggctctcttagatgtgttccgggaagctcatgcg
cagtcagtcggcgtgaatcgcctcacagaatccatcaaccgcgacagcgaagagcccttc
tcttcagttgagatccaggctgctctgagcaagatgcaggatgacaatcaggtcatggtg
tctgagggcatcgtcttcctcatttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399985Help
Entry
100399985         CDS       T03264                                 

Gene name
MCM4
Definition
(RefSeq) minichromosome maintenance complex component 4
  KO
K02212  DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100399985 (MCM4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100399985 (MCM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100399985 (MCM4)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100399985 (MCM4)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100399985 (MCM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 AAA HypA Elf1 YhdB
Motif
Other DBs
NCBI-GeneID: 100399985
NCBI-ProteinID: XP_008980851
Ensembl: ENSCJAG00000013526
Position
16
AA seq 863 aa AA seqDB search
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGADLQ
SPAAQDTLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDAAAAEDMVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDVTEPIYMQRLGEINVIGEPFLNVNCEHIKSFDKNMYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNITGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIVCQLNARTSVLAAANPIESQWDPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKMPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcccctgcgtcgaccccgagccgccgcggtagccggcgtggaagagccaccccc
gctcagacgcctcgaagtgaggatgctaggtcatctccctctcagagacgtagaggcgag
gattccacctccacaggggagctgcagccgatgccaacctcacctggagcagacctgcag
agcccagccgcgcaggacacgttattttccagccctccccaaatgcattcttcagctatc
cctcttgactttgatgttagttcaccactgacatatggcactcccagctcgagggtagag
ggaaccccaagaagtggtgttagaggcacacctgtgagacagaggcctgacttgggctcc
gcacagaagggcctgcaggtggatctgcagtctgacgcggcagcagcagaagatatggtg
gcaagtgagcagtctctaggccagaagcttgtgatctggggaacagatgtaaacgtggca
gcatgcaaagaaaattttcagagatttcttcagcgttttattgatcctctggctaaagaa
gaagaaaatgttggcatagatgttactgaacctatatacatgcaacgacttggggagatt
aatgttattggtgagccatttttaaatgtaaactgtgaacacatcaaatcatttgacaaa
aatatgtacagacagctcatctcttacccacaggaagttattccaacttttgacatggct
gtcaatgagatcttctttgaccgttaccctgactcaatcttagaacatcagattcaagta
agaccattcaacgcattgaagactaagaatatgagaaacctgaatccggaagatatcgac
cagctcatcaccatcagtggcatggtgatcaggacatcccagctgattcctgagatgcag
gaggccttcttccagtgccaagtgtgcgcccacacaacacgggtggagatggaccgcggc
cgcatcgcagagcccagtgtgtgcgggcgctgccacaccactcacagcatggcactcatc
cacaaccgctccctattctccgacaagcagatgatcaagcttcaggagtctccggaagac
atgcctgcggggcagacaccacacaccgtcatcctgtttgctcataatgatctcgttgac
aaggttcagcctggggacagagtgaatattacaggcatctatcgagcagtgcctattcga
gtcaatccaagagtgagtaatgtgaagtctgtctacaaaacccacattgatgtcattcat
tatcggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaactt
ttttcagagaaacgtgtggaattgctgaaggaactttccaggaaaccagacatttatgag
aggcttgcttcagccttggctccaagcatttatgaacatgaagatataaagaagggaatc
ttgcttcagctctttggtgggacaaggaaagattttagtcacacaggaaggggcaaattt
cgggctgagatcaacatcttgctatgtggcgaccctggtaccagcaagtcccaattgttg
cagtacgtgtacaacctggtccccaggggccagtacacatctgggaagggctccagtgca
gttggcctcaccgcgtatgtaatgaaagaccctgagacaaggcagctggtcctgcagaca
ggtgcccttgtcttgagtgacaacggcatctgctgtatcgatgagttcgacaagatgaat
gaaagtacacgatctgtactgcatgaagtcatggagcagcagactctgtccatcgcaaag
gctgggatcgtctgtcagctcaatgcacgcacctccgtcctggcagcggcaaatcccatt
gagtctcagtgggaccctaaaaaaacaaccattgaaaacatccagctacctcacacttta
ttatcaaggtttgacttgatcttcctcatgctggaccctcaggacgaagcctatgacagg
cgtctggctcaccacctggttgcactgtactaccagagcgaggagcaggcagaggaggag
ctcctggacatggcggtcctgaaggactacattgcctatgcgcacagcaccatcatgcca
cggctaagtgaggaagctagccaggctctcatcgaggcttatgtagatatgaggaagatt
ggcagtagccgtggaatggtttctgcatacccccgacagctagaatcactaatccgctta
gcagaagcccatgctaaagtaagattttctaacaaagttgaagccattgatgtggaagag
gccaaacgcctccatcgggaagctctgaagcagtctgcaactgacccccgaactggcatc
gtggacatatctattcttactacagggatgagtgccacctctcgcaaacggaaagaagaa
ttagctgaagcattgaaaaagctaattttatctaagggcaaaatgccagctctaaaatac
cagcaactttttgaagacattcgggggcaatctgacatagcaattaccaaagatatgttt
gaggaagcactgcgtgccctggcagatgatgacttcctgacagtgactgggaagaccgtg
cgcttactctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401193Help
Entry
100401193         CDS       T03264                                 

Gene name
MCM7
Definition
(RefSeq) minichromosome maintenance complex component 7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100401193 (MCM7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100401193 (MCM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100401193 (MCM7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100401193 (MCM7)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100401193 (MCM7)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100401193 (MCM7)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100401193 (MCM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_N MCM_lid Mg_chelatase AAA_5 MCM_bind AAA_3 AAA_lid_2 Sigma54_activat Mg_chelatase_C
Motif
Other DBs
NCBI-GeneID: 100401193
NCBI-ProteinID: XP_002744052
Ensembl: ENSCJAG00000015583
UniProt: F7ALH8
Position
2
AA seq 719 aa AA seqDB search
MALKDYAIEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRTRDPGMAR
SPQNQYPAELMRRFELYFQGPSSNKPRVIRDVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPVLRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELSREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPTVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaaggactacgcgatcgagaaagaaaaggttaagaagttcttacaagagttc
taccaggatgatgaacttgggaagaagcagttcaagtatgggaaccaattggttcggctg
gctcatagggaacaggtggctctgtacgtggacctggatgatgtagctgaggatgaccct
gagttggtggactcaatttgtgagaatgccaggcgctacgcaaagctgtttgctgatgcg
gtacaagagctgctgcctcagtacaaggagagggaggtggtaaataaagatgtcctggat
gtttatattgaacatcggcttatgatggagcagcggactcgggaccctgggatggcccga
agcccccagaaccagtatcccgctgaactcatgcgcagatttgagctgtattttcaaggc
ccaagcagcaacaagcctcgtgtgatccgggatgtgcgagctgactctgtggggaaattg
gtgactgtgcgtggaatcgtcacccgtgtctctgaagtcaaacccaagatggtagtggcc
acttacacttgtgaccagtgcggggcagagacctaccagccgattcagtctcccactttc
atgcctctgatcatgtgcccaagccaggagtgccaaaccaaccgctcaggagggcggctg
tatctgcagacacggggctccaaattcatcaaattccaggagatgaagatgcaagaacat
agtgaccaagtacccgtgggaaatatccctcgtagtatcacagtgctggtagaaggagag
aacacaaggatcgcccagcctggagaccatgtcagtgtcactggtatcttcctgccagtc
ttgcgcactgggttccgacaggtggtacagggtttactctcagaaacctacctggaagcc
catcggattgtgaagatgaacaagagtgaggatgatgagtctggggctggagagctcagc
agggaggagctgaggcagattgcagaggaggatttttacgaaaagctggcagcttcaatt
gccccagagatatatgggcatgaagatgtgaagaaggcactgctgctcctgctagtgggg
ggtgtggaccagtctcctcgaggcatgaaaatcaggggcaacatcaacatctgtctgatg
ggggatcctggtgtggccaagtctcagcttctgtcatatatcgatcgcctggccccccgc
agccagtacacaacaggccggggctcctcaggagtgggacttacagcagctgtgctgaga
gactccgtgagtggagaactgactttagagggtggagccctggtgctggctgaccagggc
gtgtgctgcattgatgagtttgacaagatggctgaggccgaccgaacagccatccacgag
gtcatggaacagcagaccatttctatcgccaaggctggcatcctcaccacactcaatgcc
cgctgctctatcctggctgctgccaaccctgcctatggtcgatacaaccctcgccgcagc
ctggagcagaacatacagctgcctgctgcactgctttcccggtttgacctcctctggctg
attcaggaccggcctgaccgtgacaatgacctacggttggcccagcacatcacctatgtg
caccagcacagccggcagcccccctcccagtttgaacctctggacatgaagctcatgagg
cgctacatagccatgtgccgagagaaacagcccacggtgccagagtctctggctgactac
atcacggcagcatacgtggagatgaggcgcgaggcttgggctagtaaggatgccacctat
acttctgctcggaccctgctggcaatcctgcgcctttccactgctttggcacgtctgcga
atggtggacgtggtggaaaaggaagacgtgaatgaagccatcaggctaatggagatgtca
aaggactcacttctaggcgacaaggggcagacagctaggactcagagaccagcagatgtg
atatttgccactgtccgtgaactagtctcagggggccgaagcgtccggttctctgaggca
gagcagcgctgcatatctcgtggcttcacgcccgcacagttccaggcggctctagatgag
tatgaggagctcaatgtctggcaggtcaatgcttcccggacgcggatcacttttgtctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408285Help
Entry
100408285         CDS       T03264                                 

Gene name
MCM6
Definition
(RefSeq) minichromosome maintenance complex component 6
  KO
K02542  DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100408285 (MCM6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100408285 (MCM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100408285 (MCM6)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100408285 (MCM6)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100408285 (MCM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM6_C MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 100408285
NCBI-ProteinID: XP_002749524
Ensembl: ENSCJAG00000011898
UniProt: F6R809
Position
6
AA seq 821 aa AA seqDB search
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKR
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYSEDINQEVAPKASLRLGFPEY
CRISNLIVLHLRKMEEEEDESALKRSELINWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKASTEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcggcggcagcggagcctggcgccggcagccagcatttggaggtccgcgac
gaggtggccgagaagtgccagaaactgttcctggacttcttggaggagttccagagcagc
gatggagaaattaagtacttgcaattagcagaggaactgattcgtcctgagagaaacaca
ttggttgtgagttttgtggacctggagcaatttaaccagcaactttccaccaccattcaa
gaggagttctatagagtttacccttacctgtgtcgggctttgaaaacgttcgtcaaagac
cgtaaagagatccctcttgccaaggatttttatgttgcattccaagacctgcctaccaga
cacaagattcgagaactcacctcatccagaattggtttgctcactcgcatcagtgggcag
gtggtgcgaactcacccagttcacccagagcttgtgagcggaacttttctgtgcttggac
tgtcagacagtgataagggatgtagaacagcagttcaaatacacacagccgaacatctgc
cgaaatccagtttgtgccaacaggaggagattcttactggatacaaataaatcaagattt
gttgattttcaaaaggttcgtattcaagagactcaagccgagcttcctcgagggagtata
ccccgcagtttagaagtaattttgagggctgaagctgtggaatcagctcaggctggtgac
aagtgtgactttacagggacactgattgttgtgcctgatgtctccaagcttagcacacca
ggagcacgtgcagaaactaattcccgtgtcagtggtgttgatggatatgagacagaaggc
attcgaggactccgggcccttggtgttagggacctttcttacaggctggtcttccttgct
tgctgtgttgcaccaaccaacccaaggtttggagggaaagagctcagagatgaggaacag
acagctgagagcattaagaaccaaatgaccgtgaaagaatgggagaaagtgtttgagatg
agtcaagataaaaatctataccacaatctttgtaccagcctattccctactatacatggc
aatgatgaagtaaaacggggtgtcttactgatgctctttggtggcgttccaaagacaaca
ggagaggggacctctcttcgaggggacataaatgtttgcattgttggtgacccaagtaca
gctaagagccaatttctcaagcacgtggaggagttcagccccagagctgtctataccagt
ggcaaagcatccagtgctgctggcttaacagcagctgttgtgagagatgaagaatctcat
gagtttgtcatcgaggctggagctttgatgttggctgataatggtgtgtgttgtattgat
gaatttgataagatggacgtgcgggatcaagttgctattcacgaagctatggaacagcag
acgatatccattactaaagcaggagtgaaggctactttgaacgcccggacgtccattttg
gcagcagcaaacccaatcagtggacactatgacagatcaaaatcattgaaacagaatata
aatttgtcagctcccatcatgtcccgatttgatctcttctttatccttgtggatgaatgt
aatgaggttacagattatgccattgccaggcgcatagtagatttgcattctagaattgag
gaatcaatcgatcgtgtctattcccttgatgatatcagaaggtatcttctctttgcaaga
cagtttaaacccaagatttccaaagagtcagaggacttcattgtggaacagtataaacgt
ctccgccagagggatggttctggagtgaccaagtcttcgtggaggattacagtgcgacag
cttgagagcatgattcgtctctctgaagccatggctcggatgcactgctgtgatgaggtc
caacctaaacatgtgaaggaagctttccggttactaaataaatcaatcatccgtgtagaa
acacctgatgtcaatctagatcaagaggaagagatccagatggaggtggatgagggtgct
ggtggcattaatggtcatgctgacagccctgcccctgtcaacggaatcaacggctacagt
gaagacataaatcaagaggttgctcccaaagcctccttaaggctgggcttccctgagtac
tgccgaatctctaaccttattgtgcttcacctcagaaagatggaagaagaagaagacgag
tcagcattaaagaggagcgagctcattaactggtacttgaaggaaatcgaatcagaaata
gactctgaagaagaactcataaataaaaaaagaatcatagagaaagtcattcatcgactc
acacactatgatcatgttctaattgagctcacccaggctggattgaaagcctccacagag
ggaagtgagagctacgaagaagatccctacttggtagttaaccctaattacttgctggaa
gattga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415056Help
Entry
100415056         CDS       T03264                                 

Gene name
MCM5
Definition
(RefSeq) minichromosome maintenance complex component 5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100415056 (MCM5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100415056 (MCM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100415056 (MCM5)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100415056 (MCM5)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100415056 (MCM5)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    100415056 (MCM5)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100415056 (MCM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_lid MCM_OB MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 100415056
NCBI-ProteinID: XP_017820521
Ensembl: ENSCJAG00000000511
Position
1
AA seq 750 aa AA seqDB search
MSGFDDPGIFYSDSFGGDAAADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPAGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCXDFQTLKLQELPGCKTCCP
SQNLTFSPFSYPHLRYLCDKVVPGNRVTIMGIYSIKKFGLTSSRGRDRVGVGIRSSYIRV
LGIQVDTDGSGELALGSWLSPAKRLCLHTSVCQAPLPAPRLVISWLGGDLCICYSDALTL
VGGWTGDLVLTLPISPSFPRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYT
SGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQ
QTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEH
NEERDVMLAKHVITLHVSALTQTQAVEGEIDLAKLKKFIAYCRARCGPRLSAEAAEKLKN
RYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLF
QVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYP
EHAILKVLQLMLRRGEIQHRMQRKVLYRLK
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggattcgacgatcctggcattttctacagtgacagcttcgggggggacgccgcg
gccgacgaggggcaggcccgcaaatcgcagctgcagaggcgcttcaaggagttcctgcgg
cagtaccgagtgggcaccgaccgtacgggcttcaccttcaaatacagggatgaactcaag
cggcattacaacctcggcgagtactggattgaggtggagatggaggatctggccagcttt
gatgaagacctggccgactacttgtacaagcagccagccgagcacctgcagctgctggag
gaagctgccaaggaggtggccgatgaggtcacccggccccggcctgctggtgaggaggtg
ctccaggacatccaggtcatgctgaagtcggacgccagcccttccagcattcgtagcctg
aagtcagacatgatgtcacatctggtgaagatccctggcatcatcattgcagcctcggcg
gtccgtgccaaggccacccgcatctctatccagtgccgcagctgccgaaacaccctcacc
aacattgccatgcgccctggcctggagggctatgccctgcccaggaagtgcaacacagat
caggcggggcgccccaagtgcccactggacccatacttcatcatgcccgacaaatgcaaa
tgcngtgacttccagaccctgaagctgcaggagctgcctggatgcaagacttgctgtccc
agtcagaatctcaccttttctcctttctcctatcctcatctcaggtacctgtgtgacaag
gttgtccctgggaacagggttaccatcatgggcatctactccatcaagaagtttggcctg
acctccagcaggggccgtgacagggtgggcgtgggcatccgaagttcctatatccgtgtc
ctgggcatccaggtggacacagatggctctggtgagttggctttggggtcctggctcagc
cctgccaaaaggctgtgcttgcacacttctgtctgccaggcacctttgccagcccccagg
cttgtcatcagctggctggggggtgatctctgtatctgttacagcgatgccctgactctg
gtcggggggtggactggggacctggttctcaccttgcccatctccccttccttccccagg
ctccctgatggacttactcgccgaggagacatcaacctgctgatgctaggggaccctggg
acagccaagtcccagcttctgaagtttgtggagaagtgttctcccattggggtttacacg
tctgggaaagggagcagtgcagccggactgacagcctcggtgatgagggacccttcgtcc
cggaatttcatcatggaaggtggagccatggtcctggctgatggtggggtcgtctgtatt
gatgagtttgacaagatgcgagaagacgaccgtgtggcaatccatgaagccatggagcag
cagaccatctctattgccaaggctgggatcaccaccaccctgaactctcgctgctccgtc
ctggctgctgccaactcagtgtttggccgctgggatgagacgaagggggaggacaacatt
gacttcatgcctaccatcttgtcgcgcttcgatatgatcttcattgtcaaggatgagcac
aatgaggagagggatgtgatgctggccaagcatgtcattactctgcacgtaagtgcactg
acacagacacaggccgtggagggcgagatcgacctggccaagctgaagaagtttattgcc
tactgccgagcgagatgcggcccccggctgtcagcagaggccgcagagaagctgaagaac
cgctacatcatcatgcggagcggggcccgtcagcacgagagggacagtgaccgccgctcc
agcatccccatcactgtgcggcagctggaggccattgtgcgaatcgctgaagccctcagc
aagatgaagctgcagcccttcgccacagaggcagatgtggaggaggccctgcggctcttc
caagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtggagggcttcacc
agccaggaggaccaggagatgctgagccgcatcgagaagcagctcaagcgccgctttgcc
attggctcccaggtgtctgagcacagcatcatcaaggacttcaccaagcagaaatacccg
gaacatgccatcctcaaggtgctgcagctcatgctgcggcggggcgagatccagcatcgc
atgcagcgcaaagttctctaccgcctcaagtga

DBGET integrated database retrieval system