KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385925Help
Entry
100385925         CDS       T03264                                 

Gene name
ARHGAP35, GRLF1
Definition
(RefSeq) Rho GTPase activating protein 35
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04510  Focal adhesion
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100385925 (ARHGAP35)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100385925 (ARHGAP35)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100385925 (ARHGAP35)
   04670 Leukocyte transendothelial migration
    100385925 (ARHGAP35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100385925 (ARHGAP35)
Membrane trafficking [BR:cjc04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100385925 (ARHGAP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF NOG1 Thioredoxin_13
Motif
Other DBs
NCBI-GeneID: 100385925
NCBI-ProteinID: XP_008986524
Ensembl: ENSCJAG00000011701
UniProt: U3F149
Position
22
AA seq 1499 aa AA seqDB search
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVNRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEIDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL
EKLRNERKRVEMRRAFKENLETSLFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEDFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLIGSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADI
DLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGND
GLSFFMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRKRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
KVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP
ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPLQPLLPSQLQAEHTL
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggcaagaaagcaagatgtccgaattcccacctacaacatcagtgtggtggga
ttgtctgggaccgagaaggagaagggccagtgtgggattggaaagtcttgtttgtgcaac
cgctttgtgcgcccaagtgctgacgagtttcacttggaccatacctccgtcctcagcacc
agtgactttggagggcgagtggtcaataatgaccacttcctctattggggagaagttagc
cgctccctggaggactgtgtggaatgtaagatgcacattgtggagcagactgaatttatt
gatgatcagacttttcaacctcatcgaagcacggccctgcagccctatattaagagagct
gctgcaaccaagctcgcatcagctgaaaaactcatgtacttttgcactgaccagctgggg
ctggagcaggactttgagcagaagcaaatgccagatggaaagctgctggttgatggtttt
cttcttggtatcgacgttagcaggggcatgaataggaactttgatgaccagctcaagttt
gtctccaatctctacaatcagcttgcaaaaacgaaaaagcccatagtggtggtcctgacg
aagtgtgacgaaggtgttgagcggtacattagagatgcacatactttcgccttaagcaaa
aagaacctccaggttgtggagacctcagcgaggtccaatgtaaacgtagacttggctttc
agcaccttagtgcaactcattgataaaagtcggggaaagacaaaaatcattccttatttt
gaagctctcaagcagcagagtcagcagatagctacagcaaaagacaagtatgagtggctg
gtgagtcgcattgtgaaaaaccacaatgagaactggttgagtgtcaaccgaaagatgcag
gcctccccagaataccaggactatgtctacctggaagggactcagaaagccaagaagctg
tttctccagcacatccaccgcctcaagcacgagcatatcgagcgtaggagaaagctgtac
ctggcagccctgccattagcttttgaagctcttatacctaatctagatgaaatagaccac
ctaagctgcataaaagccaaaaagctcttagaaaccaagccagaattcttgaagtggttt
gttgtgcttgaagagacaccatgggatgccaccagccacatcgacaacatggaaaacgaa
cggattccctttgatttaatggataccgtccctgcagagcagctgtacgaggcccactta
gagaagttgaggaacgagaggaaaagagttgagatgcgaagggcatttaaagaaaacctg
gagacctctcttttcataactcccggaaaaccttgggaagaggcccgtagttttatcatg
aatgaagatttctaccagtggctggaagaatctgtatacatggatatttatggcaaacac
caaaagcaaattatagataaagcaaaggaagactttcaggagttgcttctggaatattcc
gaattgttttatgagctggaactggatgctaagcccagcaaggagaagatgggtgtcatt
caggacgttctgggagaggaacagcgatttaaagcattacagaaactccaagcagagcgt
gatgccctgattctgaagcacattcattttgtgtaccacccaacaaaggagacgtgcccc
agctgcccagcttgtgtggacgctaagattgagcacttgattggttctcggtttatccgg
ccgtctgaccggaaccagaaaaattcactctctgaccccaacattgatagaatcaacttg
gttatattgggtaaagatggccttgcccgagagttggccaacgagattcgagctctttgt
acaaatgatgacaagtatgtgatagatggtaaaatgtatgagctttccctgaggccaata
gaggggaatgtcaggcttcctgtgaactctttccagacgccaacatttcagccccacggc
tgtctctgcctttacaattccaaggaatcactatcctatgtagtggaaagtatagagaaa
agtagagagtccacgcttggccggagggacaatcatttagtccatctccccctgacatta
attttggttaacaagagaggagacaccagtggagagactctgcatagcttgatacagcaa
ggtcagcaaattgctagcaaacttcagtgtgtctttctcgaccctgcttctgccggcatt
ggttatggacgcaacattaatgaaaagcaaatcagtcaagttttgaagggactcctggac
tctaagcgtaacttaaacctggtcagttctactgctagcatcaaagatttggctgatatt
gatctgcgaattgttatgtgtctgatgtgtggagatccttttagtgcagatgacatactt
tttcctgtccttcagtcccaaacctgtaagtcttcccattgtggaagcaacaactctgtt
ttacttgaactgccaatcggactacacaagaagcggattgaactgtctgttctttcatac
cattcctcgtttagcatcagaaagagccggttggttcatgggtacattgttttttattca
gccaaacgtaaggcctctttggctatgttacgtgcctttctttgtgaagtgcaggacatt
atccctattcagctcgtagcactcactgacggcgctgtagatgtcctggacaatgactta
agtcgggaacagctgactgagggggaggagattgctcaagaaattgacggaaggttcaca
agcatcccctgtagccaaccccagcataaacttgagatctttcacccgttttttaaagat
gtggtggagaaaaagaacataatcgaggctactcatatgtacgataatgctgccgaggcc
tgcagcaccaccgaagaggtgttcaactcgccccgggcagggtcaccgctctgcaactca
aacctgcaggattcagaagaagatatcgagccatcttacagcctgtttcgagaagacaca
tcactgccttctctgtccaaagaccattctaagctctctatggaactggagggaaacgat
gggctgtctttctttatgagcaattttgagagtaaactgaacaacaaagtacctccgcca
gtcaaaccaaagcctcctgttcattttgaaattacaaagggggatctgtcctatttagac
caaggccacagggatggacagaggaagtctgtgtcttctagcccctggctgcctcaggat
gggtttgatccttctgactatgccgagcccatggatgctgtggtgaagccaaggaatgaa
gaagaaaacatatactctgtgccccacgacagcacccagggcaaaatcatcaccattcgg
aatatcaacaaagcccagtccaatggcagcgggaatggttccgacagtgaaatggacacc
agctctctagagcgaggccgcaaggtttccatcgtgagcaagccagtgctgtacaggacg
agatgcacccggctggggcggtttgctagttaccgaaccagcttcagcgtggggagtgat
gatgagctgggacccatccggaagaaggaggaggatcaggcatcccagggttataaaggg
gacaatgccgtcattccatacgaaacagacgaagacccgcggaagaggaacattcttcgc
agtctaaggagaaacacgaagaaaccaaagcccaaaccccggccatccatcacaaaggca
acctgggagagtaactattttggagtacccttaacaactgtggtgactccagagaagccg
atccccatttttattgaaaggtgtattgagtacatcgaagccacaggactgagcacagaa
ggcatctacagggtcagtgggaacaagtcggagatggagagcctgcagagacagttcgat
caagaccacaacctggacttggcggagaaagactttacggtgaataccgtggccggcgcc
atgaagagctttttctcagaactgcctgaccccctggtcccatacaacatgcagatcgac
ttggtggaggcgcacaaaatcaatgaccgggagcagaagctgcatgcccttaaggaggta
ttaaagaagtttccaaaggaaaaccacgaggtcttcaagtatgtcatctctcacctaaac
aaggtcagccacaacaacaaggtgaatctcatgaccagcgagaacctctccatctgcttc
tggcccaccttgatgagacctgacttcagcaccatggacgccctcacagccacgcgcacc
taccagacaatcattgaactcttcatccagcagtgccccttcttcttctacaatcggccc
atcaccgagccccccggcgccaggcccagctccccctctgccgtggcttccactgtcccc
ttcctcacttccacgcctgtcacgagtcagccgtcacccccccagtcacctccacccacc
ccccagtccccgctgcagccactgcttccctcccagcttcaagccgaacacacgctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388004Help
Entry
100388004         CDS       T03264                                 

Gene name
ARHGAP5
Definition
(RefSeq) Rho GTPase activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04510  Focal adhesion
cjc04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100388004 (ARHGAP5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100388004 (ARHGAP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100388004 (ARHGAP5)
Membrane trafficking [BR:cjc04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100388004 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RhoGAP-FF1 FF Ras GTP_EFTU NOG1 Roc MMR_HSR1 U5_2-snRNA_bdg
Motif
Other DBs
NCBI-GeneID: 100388004
NCBI-ProteinID: XP_017832532
Ensembl: ENSCJAG00000005538
UniProt: U3C9T9
Position
10
AA seq 1501 aa AA seqDB search
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFHLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDRGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPTGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPANKDISEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRDSTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYKLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQASRVPLA
HPEDMDPSDNYAEPIDTVFKQKGYSDEIHVVSDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKIKKKTHKVKEDKKKKKTKNFNPPTRRNWESNYFG
MPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLV
SMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKILDKTERLHALKEIVKKFHPVN
YDVFRYVITHLNRVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETF
IQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLGI
I
NT seq 4506 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgtcccccatcctatactatcagtgtagttggactc
tctgggactgaaaaagacaaaggtaactgtggtgttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaacaatgatcactttttgtactggggtgacataacacaa
aatggtgaagatggagtagaatgtaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacaaatttgcaaccatatataaaacgtgcagct
gcatctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcaactaggttta
gaacaagactttgaacagaagcagatgcctgaagggaagctcaatgtagatggattttta
ttatgcattgacgtaagtcagggatgcaataggaagtttgatgatcagcttaaatttgtg
aataacctttttgtccagttatcaaaatcaaaaaaacctgtaataatagcggcaactaaa
tgtgatgaatgtgtggatcattatcttagagaagttcaggcatttgcttcaaacaaaaag
aatcttcttgtagtagaaacatcagcacgatttaatgtcaacattgaaacgtgttttact
gcactggtacaaatgttggataaaactcgtagcaagcctaaaattattccctatttggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagtttgaaaaacttgta
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacattctct
aaacatatagaacaacttaaacaggaacatataagaaaaaggagagaagagtatataaat
actttaccaagagcttttaacactcttttgccaaatctagaagagattgaacatttgaat
tggtcagaagctttgaagttaatggaaaagagagcagatttccatttatgttttgtggtg
ctagaaaaaacaccttgggatgaaactgaccatatagacaaaattaatgataggcggatt
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacaacat
ctaatatctgagaagaggagggtagaaatgaaggaaaaattcaaaaagactttggaaaaa
attcagttcatttcacctgggcagccgtgggaagaagttatgtgctttgttatggaggat
gaagccttcaaatatatcactgaagctgatagcaaagaggtatatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaagaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttctgagtgaagaacctagatataaagctttacagaaacttgcacctgatagagaatct
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgtcttagtggc
caaaattgtactgacattaaagtggagcagttacttgctagtagtcttttacagttggat
cgtggccgcttaagattatatcatgatagtaccaatatagataaagttaaccttttcatt
ttagggaaggatggccttgcccaagaactagcaaatgagataaggacacaatccactgat
gacgagtatgccttagatggaaaaatttatgaacttgatcttcggccggttgatgccaaa
tcgccttactttttgagtcaattatggactgccgcctttaaaccacacgggtgcttctgt
gtatttaattccattgagtcattgagttttattggggaatttattgggaaaataagaact
gaagcttctcagatcagaaaagataaatacatggctaatcttccatttacattaattctg
gctaatcagagagattctattagtaagaatctaccaattctcaggcaccaagggcagcag
ttggcaaacaagttacaatgtccttttgtagatgtacctactggtacatatcctcgtaaa
tttaatgaaactcaaataaagcaagctctaagaggagtattggaatcagttaaacataat
ttggatgtggtgagcccagttcctgccaataaggacatatcagaagctgacttgagaatt
gtcatgtgtgccatgtgtggagatccatttagtgtggatcttattctttcacccttcctt
gattctcattcctgcagtgctgctcaagctgggcagaataattccctaatgcttgataaa
atcattggtgaaaaaaggagacgaatacagatcacaatattatcataccactcttcaatt
ggagtaagaaaagatgaactagttcatgggtatatattagtgtactctgcaaaacggaaa
gcatcaatgggaatgcttcgagcatttctatcagaagttcaagacaccattcctgtacag
ctggtggcagttactgacagccaagcagatttttttgaaaatgaggctatcaaagagtta
atgactgaaggcgaacacattgcaactgagatcactgctaaatttacagcattgtattct
ttatctcagtatcataggcaaactgaggtctttactctgttttttagtgatgttctagag
aaaaaaaacatgatagaaaattcttacttgtctgataatacaagggattcaacccatcaa
agtgaagatgtttttctaccatctcccagagattgttttccctataacaactaccctgat
tcagatgatgacacagaagcaccgcctccttatagtccaattggggatgatgtacagttg
cttccaacacctagtgaccgttccagatataaattagatttggaaggaaatgaatatccg
attcatagtaccccaaactgtcatgaccatgaacgcaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaagacaaatgtgaaaaaactggatccaaaccttttaaaa
acaattgaagctggtattggtaaaaacccgagaaagcaggcttcccgggtgcctttggca
catcctgaagatatggatccttcagataactatgcggaacccattgatacagttttcaaa
cagaagggctattctgatgagattcatgttgtgtcagatgatagtcaaaatcgtattaaa
attcgaaactcatttgtaaataacactcaaggagatgaagaaaacggattttctgataga
acctcaaaaagtcatggggaacggaggccttcaaaatataaatataaatctaaaaccttg
tttagtaaagccaagtcatactatagacgaacacattcagatgcaagtgatgatgaggct
ttcaccacttctaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatccactt
ctttctcctgttgaaacttggaaaggtggcattgataatcctgcaatcacttctgaccag
gagttagatgataagaagataaagaagaaaacgcacaaagtgaaagaagataaaaagaaa
aagaaaactaagaacttcaatccaccaacacgtagaaattgggaaagtaattactttggg
atgcccctccaggatctggttacagctgagaagcccataccactatttgttgagaaatgt
gtggaatttattgaagatacagggttgtgtaccgaaggactctaccgtgttagcgggaac
aaaactgaccaagacaatattcaaaagcaatttgatcaggatcataatatcaatctcgtg
tcaatggaagtaacagtaaatgctgtagctggagctcttaaagctttctttgcagatctg
ccagatcctttaattccgtattctcttcatccagagctgttggaagcagcaaaaatcctg
gataaaacagaacgtcttcatgccttgaaagaaattgttaagaagtttcatcctgtaaac
tatgatgtattcagatacgtgataacacatctaaacagggttagtcagcaaaataaaatc
aacctaatgacagcagacaacttatccatctgtttttggccaaccttgatgagacctgat
tttgaaaatcgagagtttctgtctactactaagattcatcagtctgttgttgaaacattc
attcaacagtgtcagtttttcttttacaatggagaaattgtagaaacaaccaacattgtg
gctccaccaccaccttcgaatccaggacagttggtggaaccaatggtaccacttcagttg
ccaccaccattgcaacctcagctgatacaaccacaattacagacggatcctcttggtatt
atatga

DBGET integrated database retrieval system