KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386071Help
Entry
100386071         CDS       T03264                                 

Gene name
CSF1
Definition
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04380  Osteoclast differentiation
cjc04640  Hematopoietic cell lineage
cjc04668  TNF signaling pathway
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100386071 (CSF1)
   04015 Rap1 signaling pathway
    100386071 (CSF1)
   04010 MAPK signaling pathway
    100386071 (CSF1)
   04668 TNF signaling pathway
    100386071 (CSF1)
   04151 PI3K-Akt signaling pathway
    100386071 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386071 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100386071 (CSF1)
  09158 Development
   04380 Osteoclast differentiation
    100386071 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100386071 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386071 (CSF1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100386071 (CSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSF-1 Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 100386071
NCBI-ProteinID: XP_009000099
Ensembl: ENSCJAG00000003199
Position
7
AA seq 491 aa AA seqDB search
METSCQIVFQFVDQEQLKDQVCYLKKAFLLIQDIMEDTMRFRDNTPNAIAVMQLQELSLR
LNSCFTTDYEEHDKACVRTFYETPVQLLEKVRNVFNEIKNLLDEDWSIFSKNCNDTFAEC
FSKDVVTEPDCNCPKAIPSSDPASVSPHQPLAPSTAPMAGLTWDDSEGSSHLPGEQPLHT
VDPDSAKERPPRNTCQSLEPPETPVVKDETISGSPQPDPSVRAFNPGMEDILDSALGTNW
ASEEASGEASESPVPQGTELSPSRPGGGSMQAEPSRPSNFSASSPLPASANGQQLADITG
TALPRVDPIRPTDQDWSHTPQKTDGPSSLLRDPPEPDSPRISSPHPQGSSNPSTLSAQPR
LSRKHPWGSVLSLKGLESRRSTRDRRSPAELEGGPASDRAARPLARFNSVPLTDTGHERQ
PEGSSSLQLLKSVFSPLVPSVTLVLLAVGGLLFYRRRRRSRLEPQRVDSPLEQPEGSPLT
QDGDRQVELPV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagacctcatgccaaattgtctttcagtttgtagaccaggaacagttgaaagatcag
gtatgctaccttaagaaggcatttctcctgatacaagacataatggaggacaccatgcgc
ttcagagacaacacccccaatgccatcgctgtcatgcagctgcaggaactctctttgagg
ctgaacagctgctttaccacggattatgaggagcatgacaaggcctgcgtccgaactttc
tatgagacacctgtccagttgctggagaaggtcaggaatgtctttaatgaaataaagaat
ctccttgacgaggactggagtattttcagcaagaactgcaacgacacctttgctgaatgc
ttcagcaaagatgtggtgaccgagcctgattgcaactgccccaaagccatccctagcagt
gacccggcctctgtctcccctcatcagcccctcgccccctctacggcccctatggctggc
ttgacctgggatgactctgagggcagctcccacttgcctggcgagcagcccctgcacaca
gtggacccagacagtgccaaggagcgaccacccaggaacacctgccagagccttgagcca
ccagagaccccagttgtcaaggacgagaccatcagtggctcaccacagcctgacccctct
gtcagggccttcaatcctgggatggaggatattcttgactctgcattgggtactaactgg
gcctcagaagaagcctctggagaggccagtgagagtcccgtcccccaagggacagagctt
tccccctccaggccaggagggggcagcatgcaggcagagccctccagacccagcaacttc
tcagcatcttctccactccctgcatcagcaaacggccaacagctggcagacataactggt
accgccttgcccagagtggaccccatcaggcccactgaccaggactggagtcacaccccc
cagaagacagacggtccatcttccctgctcagagaccccccggagccagactctcccagg
atttcatcaccacacccccaaggctcgagcaacccctccaccctctctgctcagccacgg
ctttccagaaaacatccctggggcagtgtgctgtcccttaaggggctggagagcaggagg
agcaccagggatcggaggagcccggcagagctggaaggaggaccagcaagtgacagggca
gccaggcccctggcccgttttaactccgttcctttgactgacacaggccatgagaggcag
cccgagggatcttccagcctgcagctcctgaagtctgtcttcagcccgctggtgcccagt
gtcaccttggtcttgctggctgtcggtggcctcttgttctacagacggaggcggcggagc
cgtctagagcctcagagagtggattctcccttggagcagccagagggcagccccctgact
caggatggagacagacaggtggagctgccagtgtag

DBGET integrated database retrieval system