KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386141Help
Entry
100386141         CDS       T03264                                 

Gene name
IL21
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100386141 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386141 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100386141 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100386141 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386141 (IL21)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386141 (IL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL15 zf-IS66 DUF678
Motif
Other DBs
NCBI-GeneID: 100386141
NCBI-ProteinID: XP_002745477
Ensembl: ENSCJAG00000002755
UniProt: F7I3A3
Position
3
AA seq 162 aa AA seqDB search
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGDNERIINVSIKKLKRKPPSTKVERRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKMIHRHLSSRTHGSEDS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggatagtcatctgtctgatggtcatcttcttg
ggtacattggtccataaatcaagctctcaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggaccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcatgttttcag
aaggcccaactaaagtccgcaaatacaggagacaatgaaaggataatcaatgtatcaatt
aaaaagctgaagaggaaaccaccttccacgaaagtagagagaagacagaaacacagacta
acatgcccttcgtgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaagatgatacatcgacatctctcctctagaacacatggaagtgaa
gattcctga

DBGET integrated database retrieval system