KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386149Help
Entry
100386149         CDS       T03264                                 

Gene name
IL10, CSIF, IL-10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100386149 (IL10)
   04068 FoxO signaling pathway
    100386149 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386149 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100386149 (IL10)
   04660 T cell receptor signaling pathway
    100386149 (IL10)
   04672 Intestinal immune network for IgA production
    100386149 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100386149 (IL10)
   05322 Systemic lupus erythematosus
    100386149 (IL10)
   05320 Autoimmune thyroid disease
    100386149 (IL10)
   05321 Inflammatory bowel disease (IBD)
    100386149 (IL10)
   05330 Allograft rejection
    100386149 (IL10)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100386149 (IL10)
   05150 Staphylococcus aureus infection
    100386149 (IL10)
   05152 Tuberculosis
    100386149 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100386149 (IL10)
   05144 Malaria
    100386149 (IL10)
   05145 Toxoplasmosis
    100386149 (IL10)
   05140 Leishmaniasis
    100386149 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    100386149 (IL10)
   05143 African trypanosomiasis
    100386149 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386149 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100386149 (IL10)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386149 (IL10)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100386149 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 TSA 2_5_RNA_ligase2
Motif
Other DBs
NCBI-GeneID: 100386149
NCBI-ProteinID: XP_002760779
Ensembl: ENSCJAG00000018536
UniProt: Q0Z972
Position
19
AA seq 178 aa AA seqDB search
MHSSALLCCLVFLTGVRASPGQGTQSENSCTHFPGSLPHMLRELRVAFSRVKTFFQKKDQ
LDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFR
LRLRRCHRFLPCENKSKAVVQVKNAVSKLQEKGIYKAMSEFDIFIDYIEAYMTMKAQN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcagctctgctctgttgcctggtcttcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccactttccaggcagcctgcctcacatg
cttcgagagctccgagttgccttcagcagagtgaagactttctttcaaaagaaggatcag
ctggacagcatgctgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
catgacccagacatcaaggagcacgtgaactctctgggggaaaagctgaagaccttcagg
ctgaggctgcgacgctgtcatcgatttcttccctgtgaaaacaagagcaaggcagtggtg
caggtgaagaatgctgttagtaagctccaagagaaaggtatctacaaagccatgagtgag
tttgacatcttcatcgactacatagaagcctacatgacaatgaaagcacaaaactga

DBGET integrated database retrieval system