KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386165Help
Entry
100386165         CDS       T03264                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04015  Rap1 signaling pathway
cjc04062  Chemokine signaling pathway
cjc04137  Mitophagy - animal
cjc04144  Endocytosis
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04625  C-type lectin receptor signaling pathway
cjc04727  GABAergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05219  Bladder cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100386165 (SRC)
   04012 ErbB signaling pathway
    100386165 (SRC)
   04370 VEGF signaling pathway
    100386165 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100386165 (SRC)
   04137 Mitophagy - animal
    100386165 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100386165 (SRC)
   04520 Adherens junction
    100386165 (SRC)
   04530 Tight junction
    100386165 (SRC)
   04540 Gap junction
    100386165 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100386165 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100386165 (SRC)
   04625 C-type lectin receptor signaling pathway
    100386165 (SRC)
   04062 Chemokine signaling pathway
    100386165 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100386165 (SRC)
   04915 Estrogen signaling pathway
    100386165 (SRC)
   04917 Prolactin signaling pathway
    100386165 (SRC)
   04921 Oxytocin signaling pathway
    100386165 (SRC)
   04926 Relaxin signaling pathway
    100386165 (SRC)
   04919 Thyroid hormone signaling pathway
    100386165 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    100386165 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100386165 (SRC)
  09158 Development
   04360 Axon guidance
    100386165 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100386165 (SRC)
   05203 Viral carcinogenesis
    100386165 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    100386165 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100386165 (SRC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100386165 (SRC)
   05100 Bacterial invasion of epithelial cells
    100386165 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100386165 (SRC)
   05168 Herpes simplex virus 1 infection
    100386165 (SRC)
   05163 Human cytomegalovirus infection
    100386165 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100386165 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100386165 (SRC)
   01522 Endocrine resistance
    100386165 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100386165 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100386165 (SRC)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100386165 (SRC)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  SRC family
   100386165 (SRC)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100386165 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100386165 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100386165 (SRC)
  Macropinocytosis
   Kinases
    100386165 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100386165
NCBI-ProteinID: XP_008994148
Ensembl: ENSCJAG00000021512
Position
5
AA seq 553 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPSENAHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER
LLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQF
NSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGE
VWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEY
MSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVC
KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGR
VPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYF
TSTEPQYQPGENL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
tccgagaacgcgcacggagccggcgggggcgctttccccgcttcgcagacccccagcaag
ccagcctcggccgacggccaccgcggtcccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagatcgtcaacaacacgaggaaggtg
gatgtcagccagacctggttcacattcagatggctgcaaagagagggagactggtggctg
gcccactcgctcagcacgggacagacaggctacatccccagcaactacgtggcaccctcc
gactccatccaggctgaagagtggtattttggcaagatcaccaggcgggagtcagagcgg
ctactgctcaacgcggagaacccgagggggacattcctagtgcgggaaagtgagaccacg
aaaggtgcctactgcctctcagtgtccgacttcgacaacgccaagggcctcaacgtgaag
cactacaagatccgcaagctggacagcggcggcttctatattacctcccgcacccagttc
aacagtctgcagcagctggtggcctactactccaaacatgccgacggcctgtgccaccgc
ctcaccactgtgtgccccacgtctaagccacagactcaaggcctggccaaggatgcctgg
gagatccctcgggagtcactgcggctggaggtcaagctgggccagggctgctttggcgag
gtgtggatgggaacctggaatggcaccaccagggtggccatcaaaaccctgaagcctggc
accatgtctccggaggccttcctgcaggaggcccaggtcatgaagaaactgaggcatgag
aagctggtgcagctgtacgccgtggtttcggaggagcccatctacattgtcacggagtac
atgagcaaggggagtttgctggactttctcaagggggaaacgggcaagtacctgcggctg
cctcagctggtggacatggctgctcagatcgcctctggcatggcatatgttgagcggatg
aactacgtccatcgggaccttcgtgcagccaacatcctggtgggagagaacttggtgtgc
aaagtggccgacttcgggctggctcggctcatcgaagacaatgagtacacagcccggcaa
ggtgccaaattccccatcaagtggacggctccggaagctgccctctatggccggttcacc
atcaagtcggatgtgtggtccttcgggatcctgctgacggagctcaccacaaaggggcgg
gtgccctaccctgggatggtgaaccgagaggtgctggaccaggtggagcggggctaccgg
atgccctgcccgcccgagtgtcctgagtccctgcacgacctcatgtgccagtgctggcgg
aaagagcctgaggagcggcccactttcgagtacctgcaggcctttctggaggactacttc
acgtccactgagccccagtaccagcctggagagaacctctag

DBGET integrated database retrieval system