KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386513Help
Entry
100386513         CDS       T03264                                 

Gene name
TNFSF14
Definition
(RefSeq) tumor necrosis factor superfamily member 14
  KO
K05477  tumor necrosis factor ligand superfamily member 14
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100386513 (TNFSF14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386513 (TNFSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100386513 (TNFSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386513 (TNFSF14)
   04090 CD molecules [BR:cjc04090]
    100386513 (TNFSF14)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100386513 (TNFSF14)
CD molecules [BR:cjc04090]
 Proteins
  100386513 (TNFSF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 100386513
NCBI-ProteinID: XP_002761683
Ensembl: ENSCJAG00000016519
UniProt: F6UKH3
Position
22
AA seq 240 aa AA seqDB search
MEESVVRPSVFVVDGQTDIPFTRLGRTRRKLSCRPAPVGLGLLVSLMGAGLAVQGWFLLQ
LHWRLGEMVARLPDGGAGSWEQLIQERRSRQVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYRNGGLVATKAGYYYIYSKVQLGGVGCPQGLASTVIHGLYKRTPRYPEELELL
VSQQSPCRQATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagtgtggtgcggccctcggtgtttgtggtggacggacagacggacatcccg
ttcacgaggctgggacgaacccgccgaaaactgtcgtgcaggccggccccagtgggtctg
ggtctcttggtgtcgctgatgggggctgggctggccgtccaaggctggttcctgctgcag
ctgcactggcgtctgggagagatggtcgcccgcctgcctgacggaggtgcaggctcctgg
gagcagctgatacaagaacgaaggtctcgccaggtcaacccagcggcgcatcttacaggg
gccaactccagcttgacgggcagtgggggtccattgctatgggagacccagctgggcctg
gccttcctgaggggcctcagctaccgaaatggaggcctggtggccaccaaggctggctac
tactacatctactccaaggtgcagctgggcggtgtaggctgtccgcagggcctggccagc
accgtcatccacggcctctacaagcgcacgccccgctatcccgaggagctggagctgctt
gtcagccagcaatcaccctgcaggcaggccaccagcagctcccgcgtctggtgggatagc
agcttcctgggtggtgtggtacacctggaggctggggaggaggtggtcgtccgtgtgctg
gatgagcgcctggtccgactccgtgatggcacccggtcttacttcggggctttcatggtg
tga

DBGET integrated database retrieval system