KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386577Help
Entry
100386577         CDS       T03264                                 

Gene name
CASP7
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04668  TNF signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05200  Pathways in cancer
Module
cjc_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100386577 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100386577 (CASP7)
   04215 Apoptosis - multiple species
    100386577 (CASP7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100386577 (CASP7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100386577 (CASP7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100386577 (CASP7)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100386577 (CASP7)
   05134 Legionellosis
    100386577 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100386577 (CASP7)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     100386577 (CASP7)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C14: caspase family
   100386577 (CASP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 100386577
NCBI-ProteinID: XP_017818654
Position
12
AA seq 304 aa AA seqDB search
MADDQGCVEEQEVVDSASEDSDSVDAKPDRSSFLPTLFSKIKKNVSEQSIKTTRDXVPTY
QYSMNFEKMGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRRLGFDVIIYNDCSCAM
MQDLLKKASEEDHTNAACFACILLSHGEENLIYGKDGVTPIKDLTAHFRGDRCRTLLEKP
KLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGSG
SWFVQALCSILEEHGKDLEIMQILTRVNGRVARHFESQSDNPHFHEKKQIPCVVSMLTKE
LYFS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgatcagggctgtgttgaagagcaggaagttgtggattcagcaagtgaagat
tcagattcagtggatgctaagccagaccggtcctcatttttaccaaccctcttcagcaaa
ataaaaaaaaatgtttcagaacaatccatcaagaccacccgggacngagtgcctacgtat
cagtacagcatgaattttgagaagatgggcaaatgcatcataataaacaacaagaacttt
gataaagtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttc
aagtgcttccgaagactgggttttgacgtgatcatctataatgactgctcttgtgcaatg
atgcaagatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcc
tgcatcctcttaagccatggagaagaaaacttaatttatgggaaagatggtgtcacacca
ataaaggatttgacagcccattttaggggggatagatgcagaacccttttagagaaaccc
aaactcttcttcattcaggcttgccgagggacagagctcgatgatggcatccaggccgat
tcggggcccatcaatgacacagatgctaatccccgatataagatcccagtggaagctgac
tttctctttgcctattccacggtgccaggctattactcttggaggagcccaggaagtggc
tcctggtttgtgcaagccctctgctccatcctggaggagcatgggaaagacctggagatc
atgcagatcctcaccagggtgaatggcagagtggccaggcacttcgagtctcagtctgat
aacccacacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaagaa
ctctacttcagttaa

DBGET integrated database retrieval system