KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386674Help
Entry
100386674         CDS       T03264                                 

Gene name
ITGA5
Definition
(RefSeq) integrin subunit alpha 5
  KO
K06484  integrin alpha 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04640  Hematopoietic cell lineage
cjc04810  Regulation of actin cytoskeleton
cjc05100  Bacterial invasion of epithelial cells
cjc05133  Pertussis
cjc05135  Yersinia infection
cjc05165  Human papillomavirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100386674 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100386674 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100386674 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100386674 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100386674 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100386674 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100386674 (ITGA5)
   05205 Proteoglycans in cancer
    100386674 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100386674 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100386674 (ITGA5)
   05414 Dilated cardiomyopathy (DCM)
    100386674 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100386674 (ITGA5)
   05133 Pertussis
    100386674 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    100386674 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100386674 (ITGA5)
   05165 Human papillomavirus infection
    100386674 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100386674 (ITGA5)
   04515 Cell adhesion molecules [BR:cjc04515]
    100386674 (ITGA5)
   04090 CD molecules [BR:cjc04090]
    100386674 (ITGA5)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100386674 (ITGA5)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100386674 (ITGA5)
CD molecules [BR:cjc04090]
 Proteins
  100386674 (ITGA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 100386674
NCBI-ProteinID: XP_009002158
Ensembl: ENSCJAG00000018921
Position
9
AA seq 1098 aa AA seqDB search
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTPASTLH
AVQRRWGPRRRPPLLPLLLLLLPPPPRVGGFNLEAEAPAVLSGPPGSFFGFSVEFYRPGT
EGVSVLVGAPKANTSQPGVLQGGAVYLCPWSARRTQCTPIEFDRKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVAATDINGDGLDDLLVGAPLLMERTPDGRPQEVGRVYVYLQH
PAGIEPMPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVSCINLSFCLNASGKHVPDSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVSGEQRHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNESRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAKAQ
VTLIGVSKPEAVLFPVSEWHPRDRPQKEEDVGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTKFTGLNCTPSHPINPKDLELVPDGSLHHQQKREAPSRGSASLGPQILKC
PEAECLRLRCELGSLHHHESKSLQLHFRVWAKTFLQRKHQPFSLQCEAVYKALKMPYRIL
PRLLPQKEYQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgcccccccgccagccccctcgacaggctgggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgccagcgtccactctccac
gccgtgcagcggcgctggggcccccggcgccgacccccgctgctgccgctgctgctgctg
ctgctgccgccgccacccagggttgggggcttcaacttggaagctgaggccccagcagtg
ctctcggggcccccgggctccttcttcggattctcagtggagttttaccggccgggaaca
gagggggtcagcgtgctggtgggagcgcccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggagcgccagacgcacacagtgcacccccatt
gaatttgaccgcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcatgtgctccactgtacagctggcgcacagagaaggagccactgagcgac
cccgtgggcacctgctacctctccacagataacttcacccgaattctggagtatgcacct
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagtgcc
gagttcaccaagactggccgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctatctgccactcaggagcagattgcagaatcgtattaccccgagtacctgatc
aacctggttcaagggcagctgcagactcgccaggccagttccatctatgacgacagctac
ctaggatattccgtggctgtgggtgaattcagtggtgacgacacagaagactttgttgct
ggtgtgcccaaaggaaacctcacttacggctatgtcactatccttaatggctcagacatc
cgatccctctacaacttctcgggggaacagatggcctcctacttcggctatgcagtggct
gccacagacatcaatggggacgggctggatgacttgctggtgggggcacccctgctcatg
gagcggacccctgatgggcgacctcaggaggtaggcagggtctacgtctacctgcagcac
ccagctggcatagagcccatgcccacccttaccctcactggccatgatgagtttggccga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
atcggggctccttttggtggggagactcagcagggagtagtgtttgtattccctgggggc
ccaggagggctgggctctaagccttcccaggttctgcagcccctgtgggcagccagccac
accccagacttctttggctctgcccttcgaggaggtcgagacctggatggcaacggatat
cctgatctgattgtgggatcctttggtgtagacaaggccgtggtatacaggggccgcccc
atcgtatctgccagtgcctccctcaccatctttcctgccatgttcaacccggaggagcgc
agctgcagcttagagggaaaccctgtgtcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacacgtccccgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccttgacc
cagaccctgctcatccagaatggagctcgagaggactgcagagagatgaagatctacctc
aggaacgagtctgaatttcgagacaaactctccccaattcacatcgctctcaacttctcc
ttggaccctcaagccccggtggacagccacggcctcaggccagctctgcattaccagagc
aagagtcggatagaggacaaggcccagatcctgctggactgtggagaagacaacatctgt
gtgcctgacctgcagctggaagtatctggggagcagcgccacgtgtacttgggtgacaag
aatgccctaaacctcactttccacgcccagaatgtgggtgagggtggtgcctatgaggct
gagcttcgggtcacagcccctccagaggctgagtactcaggactcgtcagacacccaggg
aacttctccagcctgagctgtgactactttgctgtgaacgagagccgcctgctagtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggacttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcacaaagcgacgtggtttccttccggctctccgtggaggctaaggcccag
gtcaccctgatcggcgtctcgaagcctgaggcagtgctattcccggtaagcgagtggcac
ccccgagaccggccgcagaaggaggaagacgtcggacccgctgtccaccatgtctatgag
ctcatcaaccagggccccagctccattagccagggcgtgctggaactcagctgtccccag
gctctggaaggtcagcagctcctgtatgtgaccaaatttacaggactcaactgcaccccc
agtcaccccattaacccaaaggacctggagttggttcccgacggttccctgcaccaccag
cagaaacgggaagctccaagccgcggctctgcttccttgggacctcagatcctgaaatgt
ccggaggctgagtgtctcaggctgcgctgcgagctcgggtccctccaccaccatgaaagc
aaaagtctgcagctgcatttccgagtctgggccaagaccttcttgcagaggaagcaccag
ccattcagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctatcgaatcctg
cctcggctgctgccccaaaaggaatatcaggtggccacagctgtgcagtggaccaaggca
gaaggcagctatggcgtcccactatggatcattatcctagccatcctctttggcctcctg
ctcctaggtctactcatctacatcctttacaagctcggattcttcaaacgctccctccca
tacggcactgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386753Help
Entry
100386753         CDS       T03264                                 

Gene name
ITGA3
Definition
(RefSeq) integrin subunit alpha 3
  KO
K06482  integrin alpha 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04640  Hematopoietic cell lineage
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100386753 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100386753 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100386753 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100386753 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100386753 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100386753 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100386753 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100386753 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100386753 (ITGA3)
   05414 Dilated cardiomyopathy (DCM)
    100386753 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100386753 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100386753 (ITGA3)
   04515 Cell adhesion molecules [BR:cjc04515]
    100386753 (ITGA3)
   04090 CD molecules [BR:cjc04090]
    100386753 (ITGA3)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100386753 (ITGA3)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100386753 (ITGA3)
CD molecules [BR:cjc04090]
 Proteins
  100386753 (ITGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS MLANA
Motif
Other DBs
NCBI-GeneID: 100386753
NCBI-ProteinID: XP_002748485
Ensembl: ENSCJAG00000006922
UniProt: F6S164
Position
5
AA seq 1066 aa AA seqDB search
MGPRPSRAPRAPRLMLCVLALMVAAGGRVVSAFNLDTRFLVVKEAENPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMDITVKSDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCFVRGNDLQLDPSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
DPEDQGNLYIGYTVQVGSAILHPTDITIVTGAPRHRHMGAVFLLSREAGGDLRRRQLLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPHYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGFSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSWGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENSYPDLLVGSLSDRIVLLRARPVINIVYKTLVARPAVL
DPAVCTPTSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNEA
QSLENHTEIQFQKECGPDNKCESNLQMRAAFVSEQLQKLSRLQYSRDVRKLLLSINVTNP
RTSDRIGEDAHEALLTLVVPPALLLSSVRPSGACQDNETIFCELGNPFKRNQRMELLIAF
EVTGVTLHTRDLQVQLQLSTSSHQDNLQPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCQPPGDLVNPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRARCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGGATLFLRT
SVPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFK
RTRYYQIMPKYYAVRIREEERYPPPGSTLPTKKHWVTSWQTRDLYY
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccgccccagccgcgcgcctcgcgccccacgcctgatgctctgcgtgctcgcc
ttgatggtggccgccggcggccgcgtcgtctccgccttcaacctggatacccgattcctg
gtagtgaaggaggccgagaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagactgagcggcagcagcgctacctgctgctggctggtgccccccgggagctcgctgtg
cctgacggctacaccaaccggactggtgctgtgtacctgtgtccactcactgcccacaag
gacgactgtgagcggatggacatcacagtgaaaagtgaccctggccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggtcctgcaggcagagtcctggtctgt
gcccaccgctacacacaggtgctgtggtcagggtcagaagaccagcggcgcatggtgggc
aagtgcttcgtgcgaggcaatgacctacagctggaccccagcgatgactggcagacctac
cacaacgagatgtgcaacagcaacactgactacctggagacgggcatgtgccagctgggc
accagcggtggcttcacccagaacaccgtgtacttcggtgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcgtaaggactgggacttatctgaatatagttacaag
gacccagaggaccaaggaaatctctatattgggtacacggtgcaggtaggcagcgccatc
ctgcaccccacagacatcaccattgtgacaggtgccccacggcaccgacatatgggcgca
gtcttcttgctgagccgggaagctggcggagacctgcggaggaggcagctgctggagggc
tcacaggtgggcgcctactttggcagcgccattgccctagcagacctgaacaatgatggg
tggcaggaccttctggtgggtgccccccactactttgagaggaaagaggaggtagggggt
gctatctatgtcttcatgaaccaggcgggaacctccttccctgctcacccctccctcctt
cttcatggccccagtggctctgccttcggcttctccgtggccagtattggtgacatcaac
caggatggatttcaggatattgccgtgggagccccgtttgaaggcttgggcaaagtgtac
atctaccacagtagctcctggggactcctcagacagccccagcaggtaatccacggagag
aaactgggactgcctggcttggccaccttcggctactccctcagtgggcagatggatgtg
gatgagaactcctacccagaccttctagtgggaagcctgtcagaccgtattgtgctgctg
cgggcccggcccgtcatcaacatcgtctacaagaccttagtggccaggccagctgtgctg
gaccctgcagtttgcacacccacctcctgtgtgcaagtggagctgtgctttgcctataac
cagagtgctgggaaccccaactacaggcgaaacatcaccctggcgtacactctggaggcc
gacagggaccgccgcccaccccgcctccgttttgccggcagtgagtctgctgtcttccat
ggcttcttctccatgccagagatgcgctgccagaagctggagctgctcctgatggacaac
ctccgtgacaaactccggcccatcatcatctccatgaactactctttacctttgcggatg
cccgatcgtcctcgactggggctgcggtccctggacgcctatcccatcctcaacgaggca
cagtctctggagaaccacactgagatccagttccagaaggagtgcgggcctgacaacaag
tgtgagagtaatttgcaaatgcgggcagccttcgtgtcggagcagctgcagaagctgagc
aggctccagtatagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacccc
cggacctcggatcgcatcggggaggatgcccacgaggcgctgctcaccctggtggtacct
cccgccctgctgctgtcctcagtgcgcccttccggggcctgccaagataatgagaccatc
ttttgtgagctggggaaccctttcaaacggaaccagaggatggagctgctcatcgccttt
gaggtcactggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacg
tcaagtcaccaggacaacctgcagcccatgaccctgactctgctggtggactatacactc
cagacctcgctcagcatggtaaatcaccggctacaaagcttctttggggggacagtgatg
ggcgagtctggcatgaaaactgtggaggatgtgggaagccccctcaagtatgaattccag
gtgggcccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggagtgg
ccctatgaagtcagcaatggcaagtggctgctgtaccccacggagatcactgtgcatggc
aatgggtcctggccctgccaaccacctggagaccttgtcaaccctctcaacctcaccctt
tctgaccctggggataggccatcatccccacagcgcaggcggcgacagctggatccaggg
ggaggccagggccccccacctgtcactctggctgctgccaaaaaagccaagtctgagact
gtgctgacctgtgccactggccgcgcccgctgtgtgtggctggagtgccccatccctgac
gcccctattgtcaccaatgtgaccgtgaaggcacgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtccgagtaaatggcggagctaccctgttcctccgaacc
agcgtccccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactca
gagctggtggaggagctgccggctgagatcgagctgtggctggtgctggtggccgtgggt
gcggggctgctgctgctggggctgattatcctcctgctgtggaagtgtgacttctttaag
cggacccgctattaccagatcatgcccaagtactacgcggtgcggatccgtgaggaggag
cgctacccgcctccagggagcaccctgcccaccaagaagcactgggtgaccagctggcag
actcgggacctttactactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389291Help
Entry
100389291         CDS       T03264                                 

Gene name
ITGA4
Definition
(RefSeq) integrin subunit alpha 4
  KO
K06483  integrin alpha 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04640  Hematopoietic cell lineage
cjc04670  Leukocyte transendothelial migration
cjc04672  Intestinal immune network for IgA production
cjc04810  Regulation of actin cytoskeleton
cjc05135  Yersinia infection
cjc05140  Leishmaniasis
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100389291 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100389291 (ITGA4)
   04514 Cell adhesion molecules (CAMs)
    100389291 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100389291 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100389291 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100389291 (ITGA4)
   04670 Leukocyte transendothelial migration
    100389291 (ITGA4)
   04672 Intestinal immune network for IgA production
    100389291 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100389291 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100389291 (ITGA4)
   05414 Dilated cardiomyopathy (DCM)
    100389291 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100389291 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100389291 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100389291 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100389291 (ITGA4)
   04515 Cell adhesion molecules [BR:cjc04515]
    100389291 (ITGA4)
   04090 CD molecules [BR:cjc04090]
    100389291 (ITGA4)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100389291 (ITGA4)
  Exosomal proteins of other cancer cells
   100389291 (ITGA4)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100389291 (ITGA4)
CD molecules [BR:cjc04090]
 Proteins
  100389291 (ITGA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Motif
Other DBs
NCBI-GeneID: 100389291
NCBI-ProteinID: XP_008996854
Ensembl: ENSCJAG00000011542
Position
6
AA seq 650 aa AA seqDB search
MAWEARLGPCPRRAAVRETVMLLLCLGVPTGHPYNVDTESALLYQGPPNTLFGYSVVLHS
HGANRWLIVGAPTANWLANASVIHPGAIYRCKIGKNPGRTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGIPPDLRGELSKRI
APCYQDHVKKFGEHFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNMTTNIYKAFLD
GQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIEAKELSILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLIG
SDKYGARFGESIANLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGSFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESSSRFYFSSNGT
SDVISRSIQVSNRVANCRTHQAFMRKDVRDIITPIQIEAAYHLGHHIISKRSTEEFPPLQ
PILQQKKEKDMIKKMINFARFCTHENCSADLQVSAKIGFLRTISYTQKDF
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggaagccaggctcggaccctgccctcgaagggccgctgtccgggagacagtg
atgctgttgctatgcctgggggtcccgaccggccacccctacaacgtggacactgagagc
gcgctgctttaccagggcccccccaacacgctgttcggctactcggtcgtgctgcacagc
cacggggcgaaccgatggctcatagtgggtgctcccactgccaactggctcgccaacgct
tcagtgatccatcccggggcaatttacagatgcaagatcgggaagaatcccggccggacg
tgcgaacagctccagctgggtagccctaatggagaaccctgtggaaagacttgtttggaa
gagagagacaatcagtggttgggggtcacactttcgagacagccaggagaaaatggatcc
atcgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccactggtggttgctatggaataccccccgatttacgaggagaactgagtaaaagaata
gctccgtgttatcaagatcatgtgaaaaaatttggagaacattttgcatcatgtcaagct
ggaatatctagtttttatacaaaggatttaattgtgatgggagccccaggatcatcttat
tggactggctctctttttgtctacaatatgactacaaatatatacaaggcttttttagat
ggacaaaatcaagtaaaatttggaagttatttaggatattcagttggagctggtcatttt
cggagtcagcatactactgaagtagtcggaggagctcctcaacatgagcagattggtaaa
gcatatatattcagcattgaagcaaaagaactaagtatcttacatgaaatgaaaggtaaa
aagcttggctcatactttggagcttctgtctgtgctgtggacctgaacgcagatggcttc
tcagatctgctggtgggagcgcccatgcagagcaccatcagagaggaaggaagagtgttt
gtgtacatcaactctggctcgggagcagtaatgaatgcaatggaaacaaacctcattgga
agtgacaaatacggggcaagatttggagaatctatagcaaatcttggtgacattgacaat
gatggctttgaagatgttgctatcggagctccacaagaagatgacttgcgaggtgctatt
tatatttacaatggccgtgcagatgggatctcatcaaccttctctcagagaattgaagga
cttcagatcagcaaatcattaagtatgtttggacagtctatatcaggacaaattgatgca
gataataacggatatgtagatgtagcagttggttcttttcggtctgattctgctgtattg
ctaaggacaagacctgtagtaattgttgaagcttctttaagccaccctgagtcagtaaac
agaacgaaatttgactgtgttgaaaatggatggccttctgtgtgcatggatctaacactt
tgtttctcatataagggcaaggaagttccaggttacattgttttgttttataacatgagt
ttggatgtgaacagaaaggcagagtcttcatcaagattctatttttcttctaatggaact
tctgatgtgatctcaagaagcatacaagtgtccaacagagtagctaactgtagaacacat
caagcgtttatgcggaaagatgtgcgggacatcatcaccccgattcaaattgaagctgct
taccaccttgggcatcacatcatcagtaaacgaagcacagaggaattcccaccacttcag
ccaattcttcagcagaagaaagaaaaagacatgattaaaaaaatgataaactttgcaagg
ttttgtacccatgaaaattgttctgctgatttacaggtttctgcaaagattgggtttttg
aggacaataagctatactcaaaaggacttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389906Help
Entry
100389906         CDS       T03264                                 

Gene name
ITGAV
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  integrin alpha V
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04810  Regulation of actin cytoskeleton
cjc04919  Thyroid hormone signaling pathway
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05222  Small cell lung cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100389906 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100389906 (ITGAV)
   04514 Cell adhesion molecules (CAMs)
    100389906 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100389906 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100389906 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100389906 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100389906 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100389906 (ITGAV)
   05205 Proteoglycans in cancer
    100389906 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100389906 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100389906 (ITGAV)
   05410 Hypertrophic cardiomyopathy (HCM)
    100389906 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100389906 (ITGAV)
   05414 Dilated cardiomyopathy (DCM)
    100389906 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100389906 (ITGAV)
   05165 Human papillomavirus infection
    100389906 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100389906 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100389906 (ITGAV)
   04515 Cell adhesion molecules [BR:cjc04515]
    100389906 (ITGAV)
   04090 CD molecules [BR:cjc04090]
    100389906 (ITGAV)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100389906 (ITGAV)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100389906 (ITGAV)
  Exosomal proteins of epithelial cells
   100389906 (ITGAV)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100389906 (ITGAV)
CD molecules [BR:cjc04090]
 Proteins
  100389906 (ITGAV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 100389906
NCBI-ProteinID: XP_003733248
Ensembl: ENSCJAG00000005883
Position
6
AA seq 1047 aa AA seqDB search
MASPPRRRLRLGPRGLLRLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFAPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWASSRCQPIEFDATGDRNYAKDDPLEFKSH
QWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADG
QGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLATR
TAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSIYNFTGEQ
MAAYFGFSVATTDINGDDYADVLIGAPLFMDRGSDGKLQEVGQVSVSLQRTSGNFLTTKL
YGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNTVPSQIL
EGQWAARSMPPSFGYAMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYP
SILNQENKTCPLPGTALKVSCFNVRFCLKADGKGALPRKLNFQVELLLDKLKQKGAIRRA
LFLHSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADT
TGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKA
QNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAGT
QLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDRVSPVVSHQVDLAVLAAVEIRGVSSPD
HIFLPIPNWEHKENPETEEDIGPFVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYI
LHYDIDGPMNCTSDMEINPLRIKISSLQITEKNETVAEQGERDHHITKRDLALSEEDIHT
LGCGVAQCLKIICQVGRLDRGKSAILYVKSLLWTETFINKENHNHSYSLKSSASFNVIEF
PYKNLPIEYITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFF
KRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccgccgcggcgacggctgcgcctcggtccccgcggcctcctgcgtctcctc
tcgggactcctgctacctctttgccgcgccttcaacctagatgtggacagtcctgcggag
tactccggccccgagggaagctacttcggcttcgcggtggatttcttcgcgcccagcgcg
tcttcccgaatgtttcttctcgtgggagctcccaaggcaaacactacccagcctgggatt
gtagaaggagggcaagtcctcaaatgtgactgggcttctagccggtgccagccaattgaa
tttgatgcaacaggtgatagaaattatgccaaggatgatccattggaatttaagtcccat
cagtggtttggagcatctgtgaggtcaaaacaggataaaattttggcctgtgccccattg
taccattggaggacagagatgaaacaggagcgagagcctgttggaacatgctttcttcaa
gatggaacaaagactgttgagtatgctccttgcagatcgcaagatattgatgctgatgga
cagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtacttctt
ggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaaatc
atatctaaatatgaccccaacgtttacagcatcaagtataataaccaattagcaactcgg
actgcacaagctatttttgatgacagttatttgggctactctgtggctgtcggagatttc
aatggtgatggcatagatgactttgtttcaggagtaccaagagcagcaaggactttggga
atggtttatatttatgatgggaagaacatgtcctccatatacaattttactggtgagcag
atggccgcatattttggattttctgtagctaccactgacattaatggagacgattatgca
gacgtgcttattggagcacctctcttcatggatcgtggctctgatggcaaactccaagag
gtggggcaggtctcagtttctctacagagaacttcaggaaacttcctgacgacaaagcta
tacgggtttgaagtcttcgcacggtttggcagtgccatagctcctttgggagatctggac
caggatggcttcaatgatattgcaattgctgctccgtatgggggtgaagataaaaaagga
attgtttatatcttcaatggaagatcaacgggcttgaacacagtcccatctcaaatcctg
gaagggcagtgggctgctcgaagcatgccaccaagctttggctatgcgatgaaaggagcc
acagatatagacaaaaatggatatccagacttaattgtaggagcgtttggtgtagatcga
gctatcttatacagggccagaccagttattactgtaaatgctggccttgaagtgtaccct
agtattttaaatcaagaaaataaaacctgcccactgcctgggacagctctcaaagtttcc
tgttttaatgttaggttctgcttaaaggcagatggcaaaggagcacttcccaggaaactt
aacttccaggtggaacttcttctggataaactcaagcaaaagggagcaattcgacgcgca
ctgtttctccacagcaggtccccaagtcactcgaagaacatgactatttcaaggggggga
ctgatgcagtgtgaggaattgatcgcatatctgcgagatgaatctgaatttagagacaaa
ctcactccaattactatttttatggaatatcggttggattatagaacagctgctgataca
acaggcttgcaacccattcttaaccaattcacacctgccaacattagtcgacaggctcac
attctacttgactgtggtgaagacaatgtctgtaaaccaaaactggaagtttctgtagat
agtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaaggct
cagaatcaaggagaaggtgcctatgaagctgagctcatcgtttccattccactgcaggct
gatttcatcggggttgtccgaaacagtgaagccttagcaagactttcctgtgcatttaag
acagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctggaact
caactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttctgtg
aaatttgacttacaaatccaaagctcaaatctttttgacagagtaagcccagttgtatct
caccaagttgaccttgctgttttagctgcagttgagataagaggagtctcgagtcctgat
catatctttcttccaattccaaactgggagcacaaagagaaccctgagactgaagaagac
attggcccttttgttcagcacatctatgagctgagaaacaatggtccaagttcattcagc
aaagcaatgctccatctccagtggccttacaaatataacaataacactctgttgtatatc
cttcattatgatattgatgggccaatgaactgcacttcagatatggaaatcaaccctttg
agaattaagatctcatctttgcaaataactgaaaagaatgaaacagttgctgaacaaggt
gagcgggaccatcacatcactaagcgggatcttgccctcagtgaagaagatattcacact
ttgggttgtggagtcgctcagtgcttgaagattatctgccaagttggaagattagacaga
ggaaagagtgcaatcttgtatgtaaagtcattactgtggactgagacctttattaataaa
gaaaatcataatcattcctattctttgaagtcatctgcttcatttaatgtcatagagttt
ccttataagaaccttccaattgagtatatcaccaactccacattggttaccactaatgtc
acctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagcagtt
ctagcaggattgctgttactggctgttttggtatttgtaatgtacaggatgggctttttt
aaacgggtccggccacctcaagaagaacaagaaagggaacagcttcaacctcatgaaaat
ggtgaaggaaactcagaaacttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391701Help
Entry
100391701         CDS       T03264                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04640  Hematopoietic cell lineage
cjc04670  Leukocyte transendothelial migration
cjc04672  Intestinal immune network for IgA production
cjc04810  Regulation of actin cytoskeleton
cjc05135  Yersinia infection
cjc05140  Leishmaniasis
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100391701
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100391701
   04514 Cell adhesion molecules (CAMs)
    100391701
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100391701
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100391701
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100391701
   04670 Leukocyte transendothelial migration
    100391701
   04672 Intestinal immune network for IgA production
    100391701
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100391701
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100391701
   05414 Dilated cardiomyopathy (DCM)
    100391701
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100391701
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100391701
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100391701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100391701
   04515 Cell adhesion molecules [BR:cjc04515]
    100391701
   04090 CD molecules [BR:cjc04090]
    100391701
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100391701
  Exosomal proteins of other cancer cells
   100391701
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100391701
CD molecules [BR:cjc04090]
 Proteins
  100391701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 Integrin_alpha CARDB
Motif
Other DBs
NCBI-GeneID: 100391701
NCBI-ProteinID: XP_002763652
Position
6
AA seq 380 aa AA seqDB search
MKTLMLNVSLFNAGDDAYETTLHVTLPMGLYFIKILELEEKQINCEVTDNSGMVQLDCSI
GYIYVDHLSRIDISFLLDVSSLSRADEDLSITVHATCENEKEVDNLKHNRVTVAIPLKYE
VTLSVHGFVTPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFS
PQTDKLFNILDVQTTTGECNFENYQRECALEQQQSTMQTLKGIFQFFSKTDKRLLYCIKA
DPHCLNFLCNFGKMESGKEASVHIQLEGRSSILEMDETSALKFEIRATAFPEPNPRVIEL
NKDENVAHVLLEGLHHQRPKRHFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSIL
QEENRRDSWSYINSKSNDDD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaatgttgaatgtgtccttgtttaatgctggagatgatgcatatgaaact
actctacatgtcacactacccatgggtctttacttcattaagattttagagctggaagag
aaacaaataaactgtgaagtcacagataactctggcatggtacaacttgactgcagtatt
ggctatatatatgtagatcatctctcaaggatagatataagctttctcctggatgtgagc
tcactcagcagagcagacgaggacctcagtatcacagtgcatgctacctgtgaaaatgaa
aaggaagtggacaatctgaagcataacagagtgactgtagcaatacctttaaaatatgag
gttacgctaagtgttcatgggtttgtaaccccaacttcatttgtgtatggatcaaatgat
gaaaatgagcctgaaacgtgcatggtggagaaaatgaacttaactttccatgttatcaac
actggcaatagcatggctcctaatgttagtgtggaaataatggtaccaaattcttttagc
ccccaaactgataagctgttcaacattttggatgtccagactactactggagaatgcaac
tttgaaaattatcaacgagaatgtgcattagagcagcaacaaagtacaatgcagaccttg
aaaggcatattccagttcttttccaagactgataagaggctattgtactgcataaaagct
gatccacattgtttaaatttcctgtgtaattttgggaaaatggaaagcggaaaagaagcc
agtgttcatatccaattggaaggccggtcatccattttagaaatggatgagacttcagca
ctcaagtttgaaataagagcaacagcttttccagaaccaaatccaagagttattgaacta
aacaaggatgagaatgttgcgcatgttctactggaaggactacatcatcaaagacccaaa
cgtcatttcaccatagtgattatttcaagtagcttgctacttggacttattgtactttta
ttgatctcttatgttatgtggaaggctggcttctttaaaagacaatacaaatctatccta
caagaagaaaacagaagagacagttggagttatatcaacagtaaaagcaatgatgatgat
taa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397792Help
Entry
100397792         CDS       T03264                                 

Gene name
ITGA11
Definition
(RefSeq) integrin subunit alpha 11
  KO
K06587  integrin alpha 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100397792 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100397792 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100397792 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100397792 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100397792 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100397792 (ITGA11)
   05414 Dilated cardiomyopathy (DCM)
    100397792 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100397792 (ITGA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100397792 (ITGA11)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100397792 (ITGA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N
Motif
Other DBs
NCBI-GeneID: 100397792
NCBI-ProteinID: XP_002753319
Ensembl: ENSCJAG00000002269
Position
10
AA seq 1233 aa AA seqDB search
MSHGCQGAARPAQCRLQTPRRRGCRSVSPPPATAAHRTPPLHRGDMDLPKGLVVAWALSL
WPGFTDTFNMDTRKPRVIPGSKTAFFGYTVQQHEISGNKWLVVGAPLETNGHQKTGDVYK
CPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYT
TGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIG
PGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQ
KGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLN
EIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHV
VEDGVLLGAVGAYDWNGAVLKETSAGKLIPLRESYLKEFPDELKNHAAYLGYTVTSVVSS
RQGRVYVAGAPRFNHTGKVILFTMHSNRSLTIHQALRGQQIGSYFGSEITSVDINGDGVT
DVLLVGAPMYFSEGRERGKVYVYELRQNRFVYNGTLKDSHSYQNARFGSSIASVRDLNQD
SFDDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLD
EDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCF
TPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDQFTNRAVLLSSGQELCERINFH
VLDTADYVKPVAFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLVLDA
RSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAVEATLENRGENAYSTI
LNISQSANLQFASLIQKEDSDGSIECVNEERRLQKKVCNVSYPFFRAKAKVAFRLDFEFS
KSIFLHHLEIQLAAGSDSNERDSTKEDNMAPLRFHLKYESDVLFTRSSSLSHYEVKPNST
LERYDGIGPPFHCVFRIQNLGLFPIHGVMMKITVPIATRSGNRLLMLRDFLTEQMNTSCN
IWGNSTEYRPTPMEEDLSRAPQLNHSNSDVVSINCNIQLAPNQEINFHLLGNLWLKSLKA
LKYKSVKIMVHAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLL
LALLVLALWKLGFFKSARRRREPGLDPTPKVLE
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgagccacggctgtcagggagccgcgcgtcccgctcagtgcaggctgcagacgccgcgc
cgaagaggctgccgctctgtctcgccgccccccgccactgctgcacaccggaccccgccg
ctgcaccgcggggacatggacctgcccaagggcctggtggtggcctgggcgctcagcctg
tggccagggttcacggacaccttcaacatggacaccaggaaaccccgggtcatccctggc
tccaagaccgccttctttggctacacggtacagcagcacgaaatcagtggcaataaatgg
ctggtcgtgggtgccccgctggaaaccaatggccaccagaagacgggagatgtgtacaag
tgtccagtcatccacgggaactgcaccaaactcaacctgggaagggtcaccctgtccaac
gtgtccgagcggaaagacaacatgcgcctcggcctcagtctcgccaccaaccccaaggac
aacagcttcctggcctgcagccccctctggtctcacgagtgtgggagctcctactacacc
acagggatgtgttccagagtcaactccaacttcaggttctccaagaccgtggccccagct
ctccaaaggtgccagacctatatggacatcgtcattgtcctggatggctccaacagcatc
tacccctgggtggaggttcagcacttcctcatcaacatcctgaagaagttttacatcggc
ccgggacagatccaggttggagtcgtgcaatatggagaagatgtggtgcatgagtttcac
ctcaatgactacaggtctgtaaaagatgtggtggaagctgccagccacattgagcagagg
ggaggaacagagacccggacggcatttggcattgaatttgcacgctcagaggctttccag
aagggcggaaggaaaggggccaagaaggtgatgattgtcatcacagatggggagtcccac
gacagcccagacctggagaaggtgatccagcaaagcgagagagacaacgtaaccagatac
gcggtggctgttctgggttactacaatcgcagggggatcaatccggaaacttttctaaat
gaaattaaatacatcgccagtgaccccgacgacaagcatttcttcaatgtcacggatgag
gctgccttgaaggacattgtcgatgccctgggggacagaatcttcagcctggaaggcacc
aataagaatgagacctcctttgggctggagatgtcacagacaggcttttcctcgcacgtg
gtggaggatggggttctgctgggagccgtcggtgcctatgactggaacggagctgtgttg
aaggagaccagtgccgggaagctcattcctctccgcgagtcctacctgaaagagttccca
gatgagctcaagaaccatgctgcctacctggggtacacagtcacatcggtcgtgtcctcc
aggcaggggcgagtgtacgtggctggagccccccgattcaaccacacgggcaaagtcatc
ctgtttaccatgcacagcaaccggagcctcaccatccaccaggctctgcggggccagcag
ataggctcttacttcgggagtgagatcacctcggtggacatcaacggtgatggcgtgacc
gatgtcctgctcgtgggcgcacccatgtacttcagcgagggccgcgaacgaggcaaggtg
tacgtctatgagctgagacagaaccggtttgtttataacggaacgctgaaggattcccac
agttaccagaatgcccgatttgggtcctccatcgcctcggttcgagatctcaatcaggat
tccttcgatgatgtggtggtgggagcccccctagaggataaccacgcgggagccatctac
atcttccacggcttccggggcagcatcctgaagacgccaaagcagagaatcacagcctca
gagctggctaccggactccagtattttggctgcagcatccacgggcaactggacctcgat
gaggatgggctcatcgacctggcagtgggcgcccttggcaacgctgtgattctgtggtcc
cgccctgtggttcagatcaatgccagcctccactttgagccctccaagatcaacatcttc
cacagggactgcaagcgaagtggcagggatgccacctgcctggccgccttcctctgcttc
acgcccatcttcctggcaccccatttccaaacgacaactgttggcatcagatacaacgcc
accatggacgagaggcggtatacaccgagggcccacctggacgagggcggggaccaattc
accaacagggccgtcctgctctcctccggccaggagctctgtgagcggatcaacttccat
gtcctggacaccgctgactacgtgaagccagtggccttctcagtggaatattccctggag
gaccctgaccatggccccatgctggacgatggctggcccaccactctcagagtctcggtg
cccttctggaacggctgcaatgaggatgagcactgcgtccctgaccttgtgctggatgcc
cggagtgacctacccacagccatggagtactgccagagggtgctgaggaagcctgcacag
gactgctccgcatatacgctgtccttcgacaccacagttttcatcatagagagcacacgc
cggcgagtggcagtggaggccaccctggagaacaggggcgagaacgcgtacagcaccatc
ctaaatatctcacagtcagcaaacctgcagtttgccagcttgatccagaaggaggactca
gacggtagcatcgagtgcgtgaatgaggagaggaggctccagaagaaagtctgcaatgtc
agctaccccttcttccgggccaaggccaaggtggctttccgtcttgattttgaattcagc
aaatccatcttcctgcaccacctggagatccagctcgctgcaggcagtgacagtaacgag
cgggacagcaccaaggaagacaacatggcccctctgcgcttccacctcaaatatgagtct
gacgtcctcttcaccaggagcagcagcctgagccactacgaggtcaagcccaacagcacg
ctggagagatacgatggcatcgggcctcccttccactgcgtcttcaggatccagaacctg
ggcttgttccccatccatggggtgatgatgaagatcaccgttcccatcgccaccaggagt
ggcaaccgcctgctgatgctgagagacttcctcaccgaacagatgaacacatcctgtaac
atctggggaaacagcactgagtaccggcccaccccaatggaggaagacttgagtcgtgct
ccacagctgaatcacagcaattctgatgtagtctccatcaactgcaatatacagctggcc
cccaaccaggaaatcaatttccatctactggggaatctgtggctgaagtccctaaaagca
ctcaagtacaaatccgtgaaaatcatggtccacgcagccttgcagagacagtttcacagc
cccttcatcttccgtgaggaggatcccagccgccagatcgtgtttgagatctccaagcaa
gaggactggcaggtccccatctggatcattgtgggcagcaccctggggggcctcctgctg
ctggccctgctggtcctggcactatggaagctcggcttctttaaaagtgccaggcgcagg
agggagcctggtctggaccccacccccaaagtgctggagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399269Help
Entry
100399269         CDS       T03264                                 

Gene name
ITGA9
Definition
(RefSeq) integrin subunit alpha 9
  KO
K06585  integrin alpha 9
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100399269 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100399269 (ITGA9)
   04514 Cell adhesion molecules (CAMs)
    100399269 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100399269 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100399269 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100399269 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100399269 (ITGA9)
   05414 Dilated cardiomyopathy (DCM)
    100399269 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100399269 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100399269 (ITGA9)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100399269 (ITGA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 100399269
NCBI-ProteinID: XP_008982281
Ensembl: ENSCJAG00000012661
Position
17
AA seq 1035 aa AA seqDB search
MGGPAVPRGARGLRALLLALVVAGVPAGAYNLDPQRPVRFQGPANSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSTSVRSPGAVFKCRVHTNPDRRCTELDMARGKTRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYETDHILPHGFCYVIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEDLVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
SRRYTYLGYAVTAGHFSQPSTTDVVGGAPQDRGIGKVYIFRADRRSGTLIKIFEASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLTLTGDSAY
NAHFGETIASLDDLDDDGFLDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGRKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNITTCFSFHGKHIPGEIGLNYVLTADVVTKEKGQVPRVYFVLLGETVG
QVTEKLQLTYMEETCHHYVAHVKRRVQDVISPIVFEAAYSLGEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDTNVSFNVSRELFFINMWQKEEMGISCELLELDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNLERSESLHDNTLTLMVPLMHEVDTSITGIMSPT
SFVYGESMDAANFVQLDDLECHFQPINITLQIYNTGPSTLPGSSVSISFPNRLSSDGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGTSCLT
AHCNFSAIAKEESRTIDIHMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EMMVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcccggctgtgcccaggggcgccagggggctccgtgcactgctgctggcgctg
gtggtcgcgggagttcccgcgggcgcctacaacctcgacccacagcgccccgtgcgcttc
cagggccccgccaactcgttcttcggctacgcggtgctggagcatttccacgacaacacg
cgctgggtcctcgtgggcgcaccaaaggcagattccaaatacagcacctcagtgaggtcc
cctggggctgtgtttaagtgccgtgttcacaccaaccctgaccggagatgcaccgaactg
gacatggcgagagggaagactcggggcacgtcctgcggaaagacctgcagggaagaccgc
gatgatgagtggatgggggtgagcctggcccggcagcccaaggccgacggccgtgtgttg
gcctgtgcccatcgctggaagaacatctactatgaaactgaccacatcctgccacatggc
ttctgctacgtcatcccctccaacctccaggccaaaggcaggacgctgatcccttgctat
gaagagtataagaagaagtacggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcaccgaggatctggtggtgatgggggcgccagggtcattttattgggccggaacc
atcaaagtgctgaaccttacggacaacacctatttaaaactgaacgacgaagtgatcatg
agcaggcggtacacctatctgggctacgcagtgaccgctggacacttctctcagccgtcc
accaccgacgtggtaggaggtgccccacaggacagaggcatcggcaaggtttatattttc
agagccgaccgaagatcaggcaccttaattaagatctttgaagcatcaggtaaaaagatg
ggctcttacttcggctcctccttgtgcgcagttgacctgaatggggacggcctctctgac
ctgctggtgggggcccccatgttttctgagatcagggatgagggacaggtcaccgtctac
atcaacagaggaaacggagcccttgaggagcagctgactctgaccggggatagtgcctac
aatgcgcactttggagagaccattgccagcctggatgatctggacgacgatggcttctta
gatgtggccattggtgcacccaaggaggacgacttcgcaggggcggtctatatctatcat
ggtgatgccggtgggatagtccctcagtactcaatgaaactgtctgggcggaagataaat
ccagtgctccggatgtttggccagtccatatcgggagggattgatatggatgggaatggc
tatcctgatgtcactgttggagccttcatgtccgacagcgtggttcttctgagagcgagg
cctgtcattacagtggatgtctccatcttcctcccgggctccatcaacatcacggcgcct
cagtgtcatgacggacagcagcctgtcaactgcctgaacatcaccacctgcttcagtttc
catggcaaacacattccaggagagatcggcctgaattatgttctgacagctgatgtggtc
acaaaggagaagggccaggtgccccgggtctactttgtgctactgggagagaccgtgggt
caggtcacagagaagctgcagctcacttacatggaggagacgtgtcatcactatgtggcc
catgtgaagcggagggtgcaggacgtcatcagcccgatcgtgttcgaagcagcctacagc
ctcggtgagcatgtgactggagaggaggagagggaactgccgcctctgacaccggttctc
cgctggaaaaagggacagaagattgcccagaagaatcagacggtttttgaaaggaattgc
cgttcggaggactgcgccgcggacctgcagcttcagggtaaactgctgctctctagtatg
gatgagaaaaccctgtatctagcgttgggggctgtgaagaacatctccctaaacatctct
atctccaaccttggggatgatgcctatgacaccaacgtgtccttcaacgtttcccgggag
ctcttcttcattaacatgtggcagaaggaggagatgggcatctcctgtgagctgctggaa
ttggacttcctcaaatgcagcgtgggatttcctttcatgaggtcaaagtcgaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttctcagcttcatt
gttactgctcagagtggcaacctggagcgctctgaatccctgcatgacaacaccctcacg
ctgatggtgccgctgatgcacgaggtggacacatccatcactggaatcatgtctccaacc
tcctttgtatatggcgagtccatggatgcagccaacttcgttcagctggatgacctggag
tgtcactttcagcccatcaatatcacccttcagatctacaacactggcccgagcaccctt
ccagggtcatccgtcagcatctctttccctaatcgactgtcgtctgatggtgcagagatg
tttcatgtccaggaaatggtggtgggccaagagaagggaaactgctctttccagaaaaat
ccaaccccctgcatcatccctcaagaacaagaaaacatctttcacacaatatttgctttt
ttcacaaagtctggaagaaaagtcttggactgtgaaaaaccaggaacttcttgcctaaca
gcgcactgtaactttagtgctattgctaaagaggaaagtcgtactatagacatacacatg
ctgctgaacacagaaatactgaaaaaggacagttcgtctgtcatccagttcatgtcccgc
gccaaggtgaaggtggatcctgccctaagggtggtggaaatagctcacgggaacccagaa
gagatgatggtggtcttcgaggccctgcataatctggagccccgtggctacgtcgtgggg
tggatcatcgccatcagcctgttggtgggaatcctcatcttcctgctgctggccgtgctg
ctctggaagatgggcttcttccgccgaaggtacaaagaaattattgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400720Help
Entry
100400720         CDS       T03264                                 

Gene name
ITGA10
Definition
(RefSeq) integrin subunit alpha 10
  KO
K06586  integrin alpha 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100400720 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100400720 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100400720 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100400720 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100400720 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100400720 (ITGA10)
   05414 Dilated cardiomyopathy (DCM)
    100400720 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100400720 (ITGA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100400720 (ITGA10)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100400720 (ITGA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 100400720
NCBI-ProteinID: XP_008982432
Ensembl: ENSCJAG00000002231
Position
18
AA seq 1191 aa AA seqDB search
MGGKVKKTEKERDRQRPENFSYWTKRSGMELPLVTHLFLPLMLLTGLCSPFNLDEHHPRL
FPGPPEAEFGYSVLQHVGGGQRWMLVGAPWDGPSGDRRGDVYRCPVRGAHNAPCAKGHLG
DYQLGNSSHPAVNMHLGMSLLETDGDGGFMACAPLWSRACGSSVFSSGICAHVDASFRPQ
GSLAPTAQRCPTYMDVVIVLDGSNSIYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGES
PVHEWSLGDFRTKEEVVSAAKNLSRREGRETKTAQAIMVACTEGFSQSHGGRPEAARLXV
VVTDGESHDGEDTKGCEAGRVTRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFN
VTDEAALTDIVDALGDRIFGLEGSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDW
GGSVLWLEGGHRLFPPRMALEDEFPPALQNHAAYLGYSVSSMLLPGGRRLFLSGAPRFRH
RGKVIAFQLKKDGAVRVAQSLQGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQN
KETGRVYVYLVGQQTLLTLQGTLQSEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDG
HQGALYLYHGTQSGVRPHPAQRIAAASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGA
AILLSSRPIVHLAPSLEVTPEAISVVQRDCRRRGQEAVCVTAALCFQVTSRTPGRWDRRF
YVRFTASLDEWTAGARAAFDGSGQRLSAQRLRLSVGNVTCEQLLFHVLDTSDYLRPVALT
VTFALDNTTKPGPVLDEGSPTSIQKLVPFSKDCGPDNECVTDLVLQMHMDIRGSRKAPFV
VRGGRRKVLVSAILENRKENAYNTSLSLIFSGNLHLASLTPQRDSTIKVECAAPSAHARL
CSVGHPVFQTGAKVTFLLEFEFSCSSLLSQIFMKLTASSDSLERNMTLQDNTAQTSAYVQ
YEPQLLFSSESTLHRYEVYPYGTLPVGPGPEFKTTLKVRNLGCYVVSGLIISALLPAVAH
GGNYFLSLSQVITNNASCTVQNLTEPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGPLA
KGTEVSVGLLRLVHNEFFRRAKFKSLMVVSTFQLGTEQGSVLQLTEASRWSESLLEVVQT
QPLLISLWILIGSVLGGLLLLALLVFCLWKLGFFARKKIPEEEKREEKSEQ
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atgggagggaaagtaaagaaaacagaaaaagagagggacagacagaggccagagaacttc
tcatactggacaaaacgatcaggcatggagctccccctcgtcactcacctgttcttgccc
ctgatgctcctgacaggtctctgctccccctttaacctggatgaacatcacccacgccta
ttcccggggccgccggaagcggaatttggatacagcgtcttacaacacgttgggggtgga
cagcgatggatgctggtgggcgccccctgggatgggccttcaggcgaccggaggggggac
gtttatcgctgccctgtaaggggggcccacaatgccccatgtgccaagggccacttaggt
gactatcaactgggaaattcatctcatcctgctgtgaatatgcacctggggatgtctctg
ttagagacagatggtgatgggggattcatggcctgtgcccctctctggtctcgtgcttgt
ggcagctctgtcttcagttctgggatatgtgcccatgtggatgcttcattccggccccag
ggaagcctggcacccactgcccaacgctgcccaacgtacatggatgtggtcatcgtcttg
gatggctccaacagcatctacccctggtctgaagttcagaccttcctacgaagactggta
gggaaactgtttattgacccggaacagatacaggtgggactggtacagtatggggagagc
cctgtacatgagtggtccctgggagatttccgaaccaaggaagaagtggtgagcgcagcg
aagaacctcagtcggcgggagggacgagaaactaagactgcccaagccataatggtggcc
tgcacagaagggttcagtcagtcccatgggggccgacccgaggctgccaggctgnncgtg
gttgtcaccgatggagagtcccacgatggagaggacactaaaggctgtgaggctggaaga
gtgacacgctatgggattgcagtccttggtcactacctccggcggcagcgagatcccagc
tctttcctgagagaaattagaactattgccagtgacccagatgagcgattcttcttcaat
gtcacagatgaggctgctctgactgacattgtggatgcgctaggagatcggatttttggc
ctcgaagggtcccatgcagaaaatgaaagctcctttgggctggagatgtctcagattggt
ttctccactcaccggctaaaggatgggattctctttgggatggtgggggcttatgactgg
gggggctctgtgctatggcttgaaggaggtcaccgccttttccccccacgaatggctctg
gaagacgagttcccccctgcactgcagaaccacgcagcctacctgggttactctgtttct
tccatgcttttgccgggtggacgccgcctctttctctctggggctcctcgatttagacat
cgaggaaaagtcatcgccttccagcttaagaaagatggggctgtgagggttgcccagagc
ctccagggcgagcagattggttcatactttggcagtgagctctgcccattggatacagat
agggatggaacaactgacgtcttacttgtggctgcccccatgttcctgggaccccagaac
aaggaaacaggacgtgtttatgtgtatctggtgggccagcagaccttgctgaccctccaa
ggaacacttcagtcagaacccccccaggatgctcggtttggctttgccatgggcgctctt
cccgatctcaaccaagatggttttgctgatgtagctgtgggggcacctctggaagatggg
caccagggagcactgtacctgtaccatggaacccagagtggagtcaggcctcatcctgcc
cagaggattgctgctgcctccatgccacacgccctcagctacttcggccgaagtgtggat
ggccggctagatctggatggagatgatctggttgatgtggctgtgggtgcccagggggca
gccatcctgctcagctcccgacccattgtccacctggccccatcgctggaggtgacccca
gaggccatcagtgtggttcagcgggactgcaggcggcgaggccaggaggcagtctgtgtg
actgcagccctttgcttccaagtgacctcccgcactcccggtcgctgggatcgccgcttc
tatgtgcggttcacagcgtcactggatgaatggacggctggggcacgtgcagcattcgat
ggctctggccagaggctgtcggctcagaggctccggctcagtgtggggaatgtcacctgt
gagcagctgctcttccatgtgctggatacatcagattacctcaggccagtggccttgact
gtgacctttgccttggacaacaccacaaagccagggcctgtgctggatgagggctcaccc
acctccatacaaaagctggtccccttctcaaaggactgtggccctgacaatgaatgtgtc
acagacctggtgcttcaaatgcatatggacatcagaggctccaggaaggccccatttgtg
gttcgaggtggccggcggaaagtgctggtatccgcaattctggagaacaggaaggaaaat
gcttacaatactagcctgagtctcatcttctctggaaacctccacctggccagtctcact
cctcagagggacagcacaataaaggtggaatgtgcggccccttctgctcacgcccggctc
tgcagtgtggggcatcctgtcttccagactggagccaaggtgacctttctgctagagttt
gagtttagctgctcctctctcctgagccagatcttcatgaagctgactgccagcagtgac
agcctggagagaaatatgacccttcaagacaacacagctcagacctcagcctatgtccaa
tatgagcctcagctcctgttctctagtgagtctaccctgcaccgctacgaggtttacccg
tatgggaccctcccagtgggtcctggcccagaattcaaaaccactctcaaggttcggaat
ctaggctgctatgtggtcagcggcctcatcatctcagccctccttccagctgtggcccac
gggggcaattacttcctgtcactgtctcaagtcatcactaacaatgcaagctgcacagtg
caaaacctgactgagcctccaggcccccctgtgcatccagaggagcttcaacacacaaac
agactgaacgggagcaatactcagtgtcaggtggtgaggtgccaccttgggccgctggca
aaggggactgaggtctctgttggactgttgaggctggttcacaatgaatttttccgaaga
gccaagttcaagtccttaatggtggtcagcaccttccagctgggaactgagcagggcagt
gtcctacagctaactgaagcttcccgctggagtgagagcctcctggaggtggttcagacc
cagcctctcctcatctccctgtggatcctcataggcagcgtcctgggagggttgctcctg
cttgctctcctcgtcttctgtctgtggaagcttggcttctttgcccgtaagaaaatcccc
gaggaagaaaaaagagaagagaagtcagagcaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401654Help
Entry
100401654         CDS       T03264                                 

Gene name
ITGA7
Definition
(RefSeq) integrin subunit alpha 7
  KO
K06583  integrin alpha 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100401654 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100401654 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100401654 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100401654 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100401654 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100401654 (ITGA7)
   05414 Dilated cardiomyopathy (DCM)
    100401654 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100401654 (ITGA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100401654 (ITGA7)
   04515 Cell adhesion molecules [BR:cjc04515]
    100401654 (ITGA7)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100401654 (ITGA7)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100401654 (ITGA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha LYRIC Fusion_F0
Motif
Other DBs
NCBI-GeneID: 100401654
NCBI-ProteinID: XP_017831605
Ensembl: ENSCJAG00000008045
UniProt: F7F2F2
Position
9
AA seq 1141 aa AA seqDB search
MAGARSRDPWGASWICYFFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADVQKESKE
NQWLGVSVRSQAPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGEKQQDPRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHRGAVVI
LRKDSASRLVPEAVLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY
VYLNQGGHWTGISPLRLCGSPDSMFGISVAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGIVAKPSQVLEGEAVGIKSFGYSLSGNLDMDGNQYPDLLVGSLADSAVLFRARPVLH
VSHEVSIAPRSIDLEQPNCAGGHLVCVDLRVCFSYIAVPRSYNPTVALDYVLDGDTDRRL
RGQVPRVIFLRRSPDEPKHQASGTVWLKHQHDRVCGDAMFQLQENIKDKLRAIVVTLSYS
LPTPRLRRQAPGQGLPPVAPILNAHQSSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCA
RVSDTEFQPLPMDADGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVM
LPASLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLIFSTSGISIETT
ELEVKLLLATISEQELHVVSARARVFIELPLSIAGMAIPQQLFFSGVVRGESAMQSERDV
GSKVKYEVTVSNQGQSLKTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGQKGLCS
PRPNILHLDVDSRDRRRRELELPEQPEPGEQQEPSMSWWPVSSAEKKKNITLDCARGTAN
CVVFSCPLYSFDRAAVLRVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDA
STVIPVMVYLDPVAVVAEGVPWWVILLAVLAGLLVLALMVLLLWKMGFFKRAKHPEATVP
QYHAVKIPREDRQQFKEEKTGTILRSNWGSPRREGPDAHPILAADGHPELGLDGHPGPGT
A
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcggagccgcgacccttggggggcctcctggatttgctacttttttggc
tccctgctcgtcgaactgctcttctcacgggctgtcgccttcaatctggacgtgatgggt
gccttgcgcaaggagggcgagccaggcagcctcttcggcttctctgtggccctgcaccgg
cagttgcagccccgaccccagagctggctgctggtgggtgctccccaggccctggctctt
cctgggcagcaggcgaatcgcactggtggcctctttgcttgtcccttgagcctggaggag
accgactgctacagagtggacatcgaccagggagctgatgtgcaaaaagaaagcaaggag
aaccagtggttgggagtcagtgttcggagccaggcacctgggggcaagattgttacctgt
gcacaccgatatgaggcacggcagcgagtggaccagatcctggagacacgggatatgatt
ggtcgctgctttgtgctaagccaggatctggccatccgggatgagttggatggtggggaa
tggaagttctgtgaggggcgaccccaaggccatgaacaatttgggttctgccagcagggc
acagctgccgccttctcccctgatagccactacctcctctttggggcccctggaacctat
aattggaagggcacagccagggtggaactctgtgcacagggctcagcggacctggcacac
ctggatgacgggccctacgaggcggggggtgagaagcagcaggacccccgcctcatcccg
gtccctgccaacagctactttggtttctctatcgactcggggaaaggtctggtgcgtgca
gaagagctgagctttgtggctggggctccccgtgccaaccacaggggtgccgtggtcatc
ctgcgcaaggacagcgccagtcgcctggtgcccgaggctgtgctgtctggggagcgcctg
acctctggcttcggctactcgctggctgtggctgacctcaacagtgatggctggccagac
ctgatagtgggtgccccctacttctttgagcgccaagaagagctggggggtgccgtgtat
gtgtacttgaaccaggggggccattggaccggaatctccccgctccggctctgtggctcc
cctgactccatgttcgggatcagcgtggctgtcctgggggacctcaaccaagatggcttt
ccagatattgcagtgggtgccccctttgatggggatgggaaagtcttcatctaccatggg
agcagcctgggcattgtcgccaaaccttcacaggtgctggagggtgaggctgtgggcatc
aagagcttcggctactccctgtcaggcaacttggatatggatgggaaccaataccctgac
ctgctggtgggctccctggctgactctgccgtgctcttcagggccagacctgtcctccat
gtctcccatgaggtctctattgctcctcgaagcatcgacctggagcagcccaactgtgct
ggtggccacttggtctgtgtggacctaagggtctgtttcagctacattgcagtccccaga
agctataaccctaccgtggccctggattacgtgttagacggggacacagaccggaggctc
cggggccaggttccccgtgtgatcttcctgagacgtagcccagatgaacccaagcaccag
gcctcgggcaccgtgtggctaaagcaccagcatgaccgagtctgtggagatgccatgttc
cagctccaggaaaacatcaaagacaagcttcgggccattgtagtgaccttgtcctacagt
ctgccgacccctcggctccggcgacaggctcctggccaggggctgcccccagtggccccc
atcctcaatgcccaccagtccagcacccagcgggcagagatccacttcctgaaacaaggc
tgtggtgaagacaagatctgccagagcaatctgcagctggtccgtgcccgcttctgtgcc
cgggtcagcgacacggaattccagcctctgcccatggatgcagacggaacaacagccctg
tttgcactgagtgggcagccggtcattggcctggagctgatggttaccaacctgccatcg
gacccagcccagccccaggctgatggggatgatgcccatgaagcccagctcctggtcatg
cttcctgcctcactacactactcaggagtccgggccctggaccctgcggagaagccactc
tgcctatccaatgagaatgcctcccatgttgagtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctacctcatctttagcacctcagggatcagcattgagaccaca
gaactggaggtgaagctgctgttggccacgatcagtgagcaggagctgcatgtagtctct
gcacgagcccgtgtcttcattgagctgccactgtccattgcagggatggccatcccccag
caactcttcttctctggagtggtaaggggtgagagcgccatgcagtctgagcgggatgtg
ggcagcaaggtcaagtatgaggtcacggtctccaaccaaggccagtcactcaaaaccctg
ggctctgccttcctcaacatcatgtggccccatgagattgccaatgggaagtggctgctg
tacccaatgcgggtggagctggagggcggtcaggggcctgggcagaaagggctttgctct
cccaggcccaacatcctccacctggatgtggacagcagggataggaggcggcgggagctg
gagctgcctgagcaaccggagcctggtgagcagcaggagcctagcatgtcctggtggcca
gtgtcctctgctgagaagaagaaaaacatcaccctggactgtgcccggggcactgccaac
tgtgtggtgttcagctgcccactctacagcttcgacagagcggctgtgctgcgtgtctgg
ggccgtctctggaatagcacctttctggaggagtactcagctgtgaagtccctggaagtg
attgtccgagccaatatcacagtgaagtcctccataaagaacctgatgctccgagatgcc
tccacagtgatcccggtgatggtatacttggaccccgtggctgtggtggcagaaggagtg
ccctggtgggttatcctcctggctgtacttgctgggctgctggtgctggcactgatggtg
ctgctcctgtggaagatgggattcttcaaacgggcgaagcaccccgaggccaccgtgccc
cagtaccatgcagtgaagattcctcgggaagaccgacagcagttcaaggaggagaagacg
ggcactatccttaggagcaactggggcagcccccggcgggagggcccggatgcacacccc
atcctggctgctgacgggcaccccgagctgggcctcgatgggcatccaggaccaggcacc
gcctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403557Help
Entry
100403557         CDS       T03264                                 

Gene name
ITGA6
Definition
(RefSeq) integrin subunit alpha 6
  KO
K06485  integrin alpha 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04640  Hematopoietic cell lineage
cjc04810  Regulation of actin cytoskeleton
cjc05145  Toxoplasmosis
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100403557 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100403557 (ITGA6)
   04514 Cell adhesion molecules (CAMs)
    100403557 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100403557 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100403557 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100403557 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403557 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100403557 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100403557 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100403557 (ITGA6)
   05414 Dilated cardiomyopathy (DCM)
    100403557 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100403557 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100403557 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100403557 (ITGA6)
   04515 Cell adhesion molecules [BR:cjc04515]
    100403557 (ITGA6)
   04090 CD molecules [BR:cjc04090]
    100403557 (ITGA6)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100403557 (ITGA6)
  Exosomal proteins of breast milk
   100403557 (ITGA6)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100403557 (ITGA6)
CD molecules [BR:cjc04090]
 Proteins
  100403557 (ITGA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LRR19-TM
Motif
Other DBs
NCBI-GeneID: 100403557
NCBI-ProteinID: XP_002749388
Ensembl: ENSCJAG00000007399
UniProt: F6XQ72
Position
6
AA seq 1073 aa AA seqDB search
MAAAGQLCLLYLLAGLLPRLVAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPQQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDMGKVFIYHGSANGINTK
PTQVLEGTSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKMACGAPSGICLKVKACFEYTAKPAGYNPSVSIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNGQKQKVCMEETLWLQENIRDKLRPIPITASVEIQESTSRRRVNSL
PEILPILNSNEPKTAHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRSPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQWEINFLNLKESHNSRK
KREITEKQIDDSRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLTLRSRLWNST
FLEEYSKLNYLDIFVRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTAAQYSGVPWWIILV
AILAGILMLALLVVILWKCGFFKRNKKDHYDATYHKAEIHAQPSDKERLTSDA
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcggggcagctgtgcctgctctacctgttggcggggctcctgccccggctt
gtcgcagccttcaacttggacactcgcgaggacaacgtgattcggaaatatggggacccc
gggagcctcttcggcttctcgttggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccgcagcagagagccaacagaacg
ggaggcctgtacagctgcgacattaccgcccgggggccatgcacgcggatcgaattcgac
aacgatgctgatcccacgtcggaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggttgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacaaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgactgaga
ggccatgagaaatttggctcttgccagcaaggtgtagccgctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggcttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
ccaagagccaatcacagtggagctgtggttttgctaaagagagacatgaagtctgcccat
ctccttcctgagcacatattcgatggagaaggtctggcctcttcattcggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtctcaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccc
tatgatgacatgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcgagggtacctcaccgtattttggatattcaattgctggaaacatg
gaccttgatagaaattcctaccctgatgttgctgttgggtccctctcagattcagtaact
atttttagatcccggcctgtgattaatattcagaaaaccattacagtaactcctaacaga
atcgacctccgccagaaaatggcatgcggggcgcctagcgggatatgcctcaaggttaaa
gcctgtttcgaatatactgcgaaacctgctggttataatccttcagtatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatacgcaagaactaactctgaatgggcagaaacagaaa
gtgtgtatggaggaaaccctctggctacaggaaaatatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagagtcaacctctcgcaggcgagtaaattcactt
ccagaaattcttccaattctgaattcaaatgaacccaagacggctcatactgatgtgcac
ttcttaaaagagggatgtggagatgacaatgtatgtaacagcaaccttaaactagaatat
aagttttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agtccttccaatccaaggagtcccacaaaagatggcgatgatgcccatgaggctaaactc
attgcaacgttcccggacactttgacatattctgcttatagagaactgagggctttccca
gagaaacagttaagttgtgttgccaaccagaatggctcacaagctgactgtgagcttgga
aatccttttaaaagaaattcaagtgttactttttatttggttttaagtacaactgaagtc
acctttgataccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctca
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaattaacttaggt
aaacctcttaaaaaccttggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaatgggagatcaacttcctgaacctaaaggaatctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgatagcagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaatgtgaactgtgtgaacatcagatgcccg
cttcgagggctggacagcaaggcgtctctgactttgcgctcaaggttatggaacagcacg
tttctagaggaatattccaaactgaactatttggacatttttgtgcgagccttcattgac
gtgactgctgctgccgaaaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctccaagactgcggctcagtattcaggagtaccttggtggatcatcctagtg
gctattctcgctgggattttgatgcttgctttattagtggttatactatggaagtgtggt
ttcttcaagagaaataagaaagatcattatgatgccacatatcacaaggctgagatccat
gctcagccatctgataaagagaggcttacttctgatgcatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403636Help
Entry
100403636         CDS       T03264                                 

Gene name
ITGA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04145  Phagosome
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04611  Platelet activation
cjc04640  Hematopoietic cell lineage
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05222  Small cell lung cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100403636 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100403636 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100403636 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100403636 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100403636 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100403636 (ITGA2)
   04611 Platelet activation
    100403636 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403636 (ITGA2)
   05205 Proteoglycans in cancer
    100403636 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100403636 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100403636 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100403636 (ITGA2)
   05414 Dilated cardiomyopathy (DCM)
    100403636 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100403636 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100403636 (ITGA2)
   04515 Cell adhesion molecules [BR:cjc04515]
    100403636 (ITGA2)
   04090 CD molecules [BR:cjc04090]
    100403636 (ITGA2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100403636 (ITGA2)
  Exosomal proteins of bladder cancer cells
   100403636 (ITGA2)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100403636 (ITGA2)
CD molecules [BR:cjc04090]
 Proteins
  100403636 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Motif
Other DBs
NCBI-GeneID: 100403636
NCBI-ProteinID: XP_008990333
Ensembl: ENSCJAG00000001514
Position
2
AA seq 1181 aa AA seqDB search
MGPGLTGTVPLRLRLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEIKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISSDFQLSSSFSPAVQTCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVALIQYANNPRVVFNLNTYRTKEEMTLATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRPSATKVMVVVTDGESHDGSMLKAVIEQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGENTHFVAGAPRANYTGQIVLYSVNENGNVTVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIIKGILSQH
QFLEGPEGIENARFGSAIAALSDINLDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFQSHLQYFGRSLDGYEDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLFNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNVIVNQAQSCSEHIIYIQEPSDVVNSLDLRVNISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQVPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLTIPLLYDAEIHXNRSTNINFYEISSDGNVPSI
VHSFEDIGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSLSFKSENFRHTKELNCRTSSCSNVTCWFKDLHVKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEIHTYDPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIVGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggggccaggactgacagggaccgtgccactgcggctgcggctggtgttagcgctcagt
caaggcattttaaattgttgcttggcatacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctacgcggtgcagcagtttataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgcatgggagatgtg
tataaatgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttcg
acaagcattccgaatgttactgagataaaaaccaacatgagcctcggtttgaccctcaca
aggaacatgggaactggagggtttctcacatgtggtcctctgtgggcacagcagtgtggg
aatcagtattacacaacaggtgtgtgctccgacatcagttctgattttcagctctcgtcc
agcttttcacctgcagttcagacctgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtaaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacgaagacacaggtggcgttaattcagtatgccaataatcca
agagttgtgtttaacttgaatacatatagaaccaaagaagaaatgactctagcaacatcc
cagacatcccaatatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtggacgaccaagtgctaccaaagtcatggtagtt
gtaactgatggtgaatcacatgatggttcaatgttgaaagctgtgattgagcaatgcaac
catgacaatatcctgaggtttggcatagcagttctagggtacttaaacagaaacgccctt
gatactaaaaatttaataaaagagataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacgctaggagaacaa
attttcagcattgaaggtaccgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagcgcagattactctcctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacgtctcatggccatttgatctttcct
aaacaagcctttgaccaaattctgcaggacagaaaccacagttcctatttaggttactct
gtggctgcaatttctactggagaaaacacccactttgttgctggtgctcctcgggcaaat
tataccggccagatagtgctgtacagtgtgaatgagaatggcaatgtcacagttattcag
gctcaccggggtgaccagattggctcctattttggtagtgtgctgtgttcagttgatgtg
gataaagacaccattacagatgtgctcttggtgggtgcaccaatgtacatgaatgaccta
aagaaagaggaaggaagagtctacctgtttactatcataaagggcattttgagtcaacac
caatttcttgaaggccccgagggcattgaaaatgctcgatttggttcagcaattgcagct
ctttcagacatcaacctggatggctttaacgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttacaacggtcatcagggcactatccgcacaaagtat
tcccagaaaatcttgggatccgatggagcctttcagagccacctccagtactttgggagg
tccttggatggctatgaagatttaaatggggattccatcaccgatgtgtccattggtgcc
tttggacaagtggttcaactctggtcacagagtattgctgatgtagctatagaagcttca
ttcacaccagaaaaaataactttgttcaacaagaatgctcagataattctcaaactatgc
ttcagtgcgaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccaggggcttatttaaagaaaac
aatgagagatgcctgcagaagaatgtaatagtaaatcaagcacagagttgctctgagcac
atcatttatatacaggagccatctgatgttgtcaactctttggatttgcgtgtgaatatc
agcctggaaaaccctggcactagccctgcccttgaagcttattctgagactgccaaggtc
ttcagtattccatttcataaagactgtggtgaggatggactctgcatttctgatctagta
ctagatgtccgacaagtaccagctgctcaagaacaaccctttattgtcagcaaccaaaac
aaaaggttaaccttttcggtaacgctgaaaaacaaaagggaaagtgcatacaacaccgga
attgttgttgatttttcagaaaacttgttttttgcttcattctccctgccggttgatggg
acagaagtaacgtgtcaggtggctgcctctcagaagtctgttgcttgcgatgtaggctac
cctgctttaaagagagaacaacaggtgacttttactattaacttcgacttcaatcttcaa
aaccttcagaatcaggcatctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttagtcaatctcacaattcctctcctgtatgatgctgaaattcactnc
aacagatccaccaacataaatttttatgaaatctcttcggatggaaatgttccttctatt
gtgcacagttttgaagatattggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcaatataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacgtcttcttctctatctttcaaaagtgaa
aatttcaggcacacgaaagaattgaactgcagaacctcttcctgtagtaatgttacctgc
tggttcaaagaccttcacgtgaaaggagaatactttgttaatgtgactaccagaatttgg
aatgggacttttgcatcatcaactttccagacggtacagctaacggcagctgcagaaatc
cacacctatgaccctgagatatacgtgatcgaagataacactgttacgattcccctgatg
ataatgaaacctgatgagaaagctgaagtaccaacaggagttatagtaggaagtataatt
gctggaatccttttgctgttagctctggttgcaattttatggaagcttggcttcttcaaa
agaaaatatgaaaagatgaccaaaaatccagacgagattgatgagaccacagaactcaat
agctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404358Help
Entry
100404358         CDS       T03264                                 

Gene name
ITGA1
Definition
(RefSeq) integrin subunit alpha 1
  KO
K06480  integrin alpha 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04640  Hematopoietic cell lineage
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100404358 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100404358 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404358 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100404358 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100404358 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100404358 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100404358 (ITGA1)
   05414 Dilated cardiomyopathy (DCM)
    100404358 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100404358 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100404358 (ITGA1)
   04515 Cell adhesion molecules [BR:cjc04515]
    100404358 (ITGA1)
   04090 CD molecules [BR:cjc04090]
    100404358 (ITGA1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100404358 (ITGA1)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100404358 (ITGA1)
CD molecules [BR:cjc04090]
 Proteins
  100404358 (ITGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 LYRIC Integrin_alpha Cation_ATPase_N
Motif
Other DBs
NCBI-GeneID: 100404358
NCBI-ProteinID: XP_017825419
Ensembl: ENSCJAG00000001502
Position
2
AA seq 1179 aa AA seqDB search
MAPRFRARPGVAVACCWLLTVFLGFCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGKSLPCVKLDLPVNTSIPDVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKADKIIIPQNTT
FNVESTKMNEPLASYLGYTVNSATAAAGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSQQRNSCKKQNKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVAMNFEPNKVNIQKKNCRMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVILDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKGKCISDLSLNVTTTEKDLLIVRSQNDKFN
ISITVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSFLMENVTIHLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGYFPMPELKLSISFPNMTSNGYPVLYPT
GVSSSDNAKCRPHISEDSFSINSGKKLITSTDHLKQGTILDCSTCKFATITCNLIPSDMS
QVNVSLILWKPTFIKSYFSSLNLTITGELQSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggccccccggttccgcgcccgtccaggggtcgctgtcgcctgctgctggctcctcact
gtttttctaggcttctgtgtatccttcaatgttgatgtgaaaaattcaatgactttcagc
ggcccagtggaagacatgtttggatatactgttcaacagtatgaaaatgaagaaggaaaa
tgggtgcttattggttctcctttagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtaaatcattaccttgcgtaaagttggatctaccagttaat
acatcaattcccgatgtcacagaagtaaaggagaacatgacatttggatcaactttagtc
accaacccaaacggaggatttctggcatgtgggcccttatatgcctatagatgtggacat
ctgcattacacaactggaatctgttctgacgtcagccccacatttcaagtcgtgaactcc
attgcccctgtacgagaatgcagcactcaactggacatagtcatagtgctggatggttcc
aacagcatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gacattggtcctaaacagacacaggttggaattgtgcagtatggagaaaacgtgacccat
gagttcaatctcaataagtattcttcaacggaggaggtacttgttgccgcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcatttactgaagcccggggtgcccgaagaggggttaaaaaagtcatggtcattgtgacg
gatggagagtcccatgacaatcatcgactgaaaaaggtcatccaagactgtgaagatgaa
aacattcaacgattttccatagctattcttggcagctataaccgaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagtgaacccactgaaaagcacttcttc
aacgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gctctggaagctacagctgaccagtcagcggcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctgataaaatcataatccctcaaaacacaact
tttaatgttgagtccaccaaaatgaatgaacctcttgcttcttatttaggttacacagta
aactctgccactgctgctgctggggatgtgctgtatattgccggacagcctcgatacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagaca
ctcagtggagaacagattggttcctactttggcagtattttaacaacaattgacattgat
aaggattctaatactgacattcttctagttggagcccctatgtacatgggaacggagaaa
gaggagcaaggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctattaagcagacatgctgttcatctcagcagcgcaattcatgcaaaaaa
caaaacaaaaatgagccatgtggggctcgttttggaactgctattgctgccgtaaaagac
ctcaatcttgatggatttaatgacatcgtgataggagcaccactggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagactataagaaaagagtatgcacaacgt
attccatcaggtggggatggtaagacactgaaattttttggtcagtctatccacggagaa
atggatttaaatggtgatggtctgacagatgtgactattgggggccttggcggtgctgcc
ctcttctggtcccgagatgtggctgtagttaaagtggccatgaattttgagccaaataaa
gtgaatattcaaaagaaaaactgccgtatggaaggaaaggaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaaatctaaagaagatactatttacgaagctgatttg
cagtaccgtgtcatcctagattcactaagacaaatatcacgaagttttttctctggaact
caagagagaaaggttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaagcatgactttcaggactctgtaagaataacgttggattttaat
ctcactgatccagaaaatgggcctgttcttgatgattctctaccaaactcagtacatgaa
tatattccctttgccaaagattgtggaaacaagggaaaatgtatctcggacctcagcctt
aatgtcaccaccacagaaaaggacctgctgattgtccggtcccagaatgataagttcaac
attagcatcacagtgaaaaatacaaaggacagtgcctataacaccaggacaatagtgcat
tattctccaaatctggtgttttcaggaattgaggctatccaaaaagacagttgtgaatcc
aatcataatatcacatgtaaagttggatatcccttcctcagaagaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctttctcatggaaaatgtgaccattcattta
agtgcaacaagtgacagtgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctatcccggtaaaatatgaagttggactacagttttacagctctgccagtgaataccac
atttcaattgctgccaatgagacagtccctgaagttattaattctactgaggacattgga
aatgaaattaatatcttctacttgataagaaaaagtggatattttccaatgccagaactt
aagctgtcaatttcattccccaatatgacatcaaatggttatcctgtgctgtacccaact
ggagtgtcatcttctgataatgcaaagtgcagaccccatatctctgaggattctttcagt
atcaactctggaaagaaactgattacatcaactgaccatcttaaacaaggaacaattctg
gactgcagtacatgtaaatttgctaccatcacgtgtaatctcattccttctgacatgagc
caagtgaatgtttcgcttatcttgtggaaaccaacttttataaaatcatatttttccagc
ctaaatcttactataacaggagaacttcagagtgaaaatacatcactggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatttccaaagatgggctaccaggcagagtg
ccattatgggtcatcctgctgagtgcttttgctggattattgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccactgaaaaagaaaatggagaaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404891Help
Entry
100404891         CDS       T03264                                 

Gene name
ITGA8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  integrin alpha 8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100404891 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100404891 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    100404891 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404891 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100404891 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100404891 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100404891 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    100404891 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100404891 (ITGA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100404891 (ITGA8)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100404891 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 100404891
NCBI-ProteinID: XP_002750107
Ensembl: ENSCJAG00000009080
Position
7
AA seq 1063 aa AA seqDB search
MSPRASCGPRGSRAPPIASVCCAAAALGMLLWSSASQAFNLDVEKLTVYSGPEGSYFGYA
VDFYIPDAHTASVLVGAPKANTSQPNIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHRGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTVVISDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAISVPFAGKDQRGQVL
IYNGNKGGLNTKPSQVLQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLNPVIISLENKTCQIPDAMTSAACFSLRVCASVRGQSISNTIVLMA
DVQLDSLKQKGAIKRTLFLDNHQAHRVFPLVIKRQKSHQCQDFIVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENVVSEQAHILVDCGEDNLCVPELKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPPSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNSVSVQIN
ITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPRKEEEVGPLVEHIYELHNIGPSTINDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQTNPDINPRDLKPAASPEDTPELSAFLRNSTIP
HLVRKRDVPVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYKDQPAKLPEGSMAIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDREQLTNDKTSEA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccagggccagctgcggtccccggggaagccgggcgccgccgatcgcatccgtc
tgctgcgctgcagccgcgctggggatgctgctgtggtcctccgcctcacaagcgttcaac
ctggacgtggagaagctcacggtgtacagcggtcccgagggcagctacttcggctacgcg
gtggacttctacatacccgacgcccacacagcgagtgtcttggtgggggcacccaaagcc
aacaccagccagcccaatatcgtggaaggaggagccgtctattactgtccttggcccgcg
gaggggtctgcgcagtgcaggcagataccgtttgacaccaccaacaacagaaagatcaga
gttaatggaaccaaagaacctattgagtttaaatcgaatcagtggtttggagcaacagtg
aaagctcacagaggaaaagtggtggcctgtgctcctttgtatcactggagaactcttaag
ccaacaccagaaaaggatccagttggcacctgctatgtagcaattcagaactttagtgcc
tacgccgagttctctccttgccggaacagcaatgctgatccagaaggccagggttactgt
caagccggatttagtctggatttttacaagaatggagaccttatcgtagggggaccgggg
agtttctactggcaaggtcaagtaatcactgccagtgttgcagatatcattgcaaattac
tccttcaaggatattctcaggaaactggcaggagaaaagcagacagaagtggctccagct
tcatatgatgacagttaccttggatattcagttgctgctggggagtttactggggattct
cagcaagaattggttgctggagttccaagaggagcacagaattttggatatgtttcaatc
attaactctacagatatgacctttattcagaatttcactggcgaacagatggcatcttat
tttggatataccgtggtcatatcagatgtaaacagcgatggactggatgacgtcctggtt
ggggcacctctctttatggagcgtgaatttgagagtaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctctctcctcttcagagacccccagatcctcactggcaca
gaaacgtttgggaggttcggtagtgctatggcgcatttaggagacctgaaccaagatgga
tacaatgacattgccatcagcgtgccctttgcaggcaaggatcaaagaggccaagtgctc
atttataacgggaacaagggaggcttaaacaccaagccttcccaagtgctgcaaggagtg
tgggcctcacaggctgtcccttccggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatctgattgttggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccagttgtgactgtagatgcccagcttctgctgaacccagtgattatc
agtcttgaaaataaaacctgccagattccagacgctatgacctccgcagcctgcttttct
ttgagagtatgtgcgtctgtcagaggccagagcatttcgaacacaatagtcttgatggca
gacgtgcaattagattccctgaaacagaaaggggccattaaacggacgctcttccttgat
aaccaccaggctcatcgcgtcttcccgcttgtgataaaacggcagaaatctcaccagtgc
caggatttcatcgtttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggatgaatccacctttaaagaaggcctggaagtgaaa
ccaatactgaactactacagagaaaacgttgttagtgaacaggctcacattctggtggac
tgtggagaagacaatctgtgtgttcctgagttgaagctgtcagctagaccagataagcat
caggtaatcattggagatgaaaatcacctgatgctcataataaatgcaagaaatgaaggg
gaaggagcctatgaagctgaactctttgtaatgataccagaagaggcagattatgttggg
attgaacgcaacaacaagggatttcgaccaccgagctgtgagtataagatggaaaatgta
accaggatggtggtgtgtgaccttgggaaccctatggtgtctggaacaaattattctctg
ggcctccgatttgcagttccacgtcttgagaaaacaaacatgagcattaacttcgatctc
caaatcagaagttccaacaaggacaatccagacagcaattctgtgagcgtgcaaatcaac
atcactgctgtggcacaggtggaaataagaggagtgtcgcaccctccacagattgttctg
cccattcacaactgggaaccagaagaagaaccccgcaaagaggaggaggttggaccattg
gtggaacatatttatgagctgcacaatattggaccaagtacgatcaatgacaccatcctg
gaggtgggctggcctttctctgcccgggatgaatttcttctctatattttccatattcaa
actctgggacctctgcagtgtcagacaaatcctgatatcaatccacgggatctaaagcct
gctgcctccccagaggacacccctgagctcagcgcctttttgcgaaactctaccattcct
catcttgtcaggaagagggatgtgcctgtggttgaattccacagacaaagccctgcaaaa
atactgaactgtacaaatatcgagtgtttacaaatctcctgtgcagtgggacgactcgag
ggaggagaaagtgcagtcctgaaagtcaggtcacgactatgggcccacacattcctccag
agaaaaaatgatccctatgctcttgcatccctggtgtcctttgaagttaagaagatgcct
tataaagatcagccagcaaaactcccagaaggaagcatggcaattaagacatcagttatt
tgggcaaccccgaatgtttccttctcaatcccattatgggtaataatactagcaatactt
cttggattattggttctggccattttaactttagctttatggaagtgtggattctttgac
agagccagacctcctcaggaggacatgactgatagggaacagctgacaaatgacaagacc
tctgaggcatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408748Help
Entry
100408748         CDS       T03264                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin subunit alpha 2b
  KO
K06476  integrin alpha 2B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04611  Platelet activation
cjc04640  Hematopoietic cell lineage
cjc04810  Regulation of actin cytoskeleton
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100408748 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    100408748 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100408748 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100408748 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100408748 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100408748 (ITGA2B)
   04611 Platelet activation
    100408748 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408748 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100408748 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100408748 (ITGA2B)
   05410 Hypertrophic cardiomyopathy (HCM)
    100408748 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100408748 (ITGA2B)
   05414 Dilated cardiomyopathy (DCM)
    100408748 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100408748 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100408748 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408748 (ITGA2B)
   04515 Cell adhesion molecules [BR:cjc04515]
    100408748 (ITGA2B)
   04090 CD molecules [BR:cjc04090]
    100408748 (ITGA2B)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100408748 (ITGA2B)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100408748 (ITGA2B)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100408748 (ITGA2B)
CD molecules [BR:cjc04090]
 Proteins
  100408748 (ITGA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 100408748
NCBI-ProteinID: XP_017827894
Ensembl: ENSCJAG00000009821
Position
5
AA seq 1106 aa AA seqDB search
MNTHTLGGLTHFLAILATMSPGATTLYSAHCSASYFSFQFDKKRLPVEESEGKKEELAHS
CLGGCGRRKMALCPLQALWLLEWVLLLLGPCASPPAWALNLDPVQLTYYAGPNGSHFGFS
LDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCSSLLFDLRDETRYVGSQ
TLQTFKACQGLGASVVSWSDTIVACAPWQHWNVLEKIEEAEKTPVGGCFLAQPQSGRRAE
YSPCRGNTLSRVYLENDFSGDRRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLSQAPIAN
IFSSYRPGTLLWHVSSQSFSFDSSNPEYFDGYWGYSVAVGDFDGDLNTTEYVVGAPTRSW
TMGAVEILDSYYQRLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKL
AEVGRVYLFLQPRGSQLLGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDVAVAAPYGG
PSGRGQVLVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGA
SQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKL
YLNAELQLDRQKPRQGRRVLLLDSQQAGTTLNLDLSGRHSPICQTTMAFLRDEADFRDKL
SPIVLSLNVSLPSKEAGIAPAVMLHGDTHVQEQTRIILDCGEDDVCVPQLQLTANMTGSP
LLVGADNVLELQMDAANKGEGAYEAELTVHLPQGAHYMRALSNVEGFERLICNQKKENET
SVVLCELGNPMKKNAQIGIAMLLSVGNLEEAVESVSFQLQIRSKNSQNPNSKMVLLEVPV
WAEAQVELRGNSFPASLVLAAEEGDKEQNSLVSWGPKVEHTYELHNNGPGTVKGLRLRIH
LPGQSQPSDLLYILDLQPQGGLQCSPQPPINPLQVDWGLPTTSPSSIHPAHHKRDRRQIV
LPEPGQPSRLQDPILVSCDSETCTVVECDLQEMARGQRAMVTILAFLWLPSLRQRPLDQF
VLQSHAWFNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVPVGVLGGLLLLTL
LVLAMWKVGFFKRKRPPLEEDDEEEE
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacactctgggtggcctcacccacttcctggcgatcctagcgaccatgagt
ccaggggctacaaccctttactctgcccactgctcagcaagttacttcagtttccagttt
gataagaaaagacttcctgtggaggaatctgaagggaagaaggaggagctggcccattcc
tgcctgggaggttgtggaagaaggaagatggctttgtgtccactgcaagccctttggctt
ctagaatgggtgctgctgctcttggggccttgtgcttcccctccagcctgggccttgaac
ctggacccagtgcagctcacctactatgcaggccccaatggcagccactttggattttca
ctggacttccacaaggacagccatgggagagtggccatcgtggtgggcgccccgcggacc
ctgggccccagccaggaggagacgggcggcgtgttcctgtgcccctggagggccgagggc
ggccagtgctcctcgctgctctttgacctccgtgatgagacccgatatgtaggctcccag
actttacaaaccttcaaggcctgccaaggactgggggcgtcggtcgtcagctggagcgac
accattgtggcctgcgccccctggcagcactggaacgtcttagaaaagattgaggaggct
gaaaagacgccggtaggcggctgctttctggctcagccgcagagcggccgccgagccgag
tattccccgtgtcgcggaaacaccctgagccgcgtttacttggaaaatgatttcagcggg
gaccggcgttactgtgaagcgggcttcagctccgtggtcactcaggctggggagctagtg
cttggggctcctggcggctattatttcttaggtctcctgtcccaggctccaattgcgaat
attttctcgagttaccgcccgggcacccttttgtggcacgtgtcctcccagagcttctcc
ttcgactccagcaacccagagtacttcgacggctactgggggtactcggttgctgtgggc
gacttcgacggggatctcaatactacagagtatgtcgtcggtgcccctactaggagctgg
accatgggagccgtggaaattttggactcctactaccagaggctgcaccgactgcacgga
gagcagatggcttcgtattttgggcactcagtggctgtcactgacgtcaacggggatggg
aggcatgacctgctggtgggtgctccactgtacatggagagccgagcagaccgaaaactg
gcagaagtggggcgtgtgtatttgttcctgcagccccgaggctcccaactgctgggtgcc
cccagcctcctgctgactggcacacagctctatgggcgattcggctctgccatcgcaccc
ctgggcgacctcgaccgggatggctacaatgatgttgcagtggctgccccctacgggggt
cccagtggccgtggccaagtgctggtgttcctgggtcagagtgaggggctgagctcacgt
ccctcccaggtcctggacagccccttccccacaggttctgcctttggcttctcccttcga
ggtgccgtagacattgatgacaatggatacccagacctgatcgtgggagcttacggggct
agccaggtggctgtgtacagagcccagccagtggtgaaggcctctgtccagctactggtg
caagattcactgaatcctgctgtgaagagctgtgtcctaccccagaccaagacacccgtg
agctgcttcaacatccagatgtgtgttggagccaccggacacaacattcctcaaaagctg
tacctaaatgctgagctgcagctggatcggcagaagccccgccagggccggcgggtgcta
ctgctggattctcaacaggcgggcaccaccctaaacctggacctgagcggaaggcacagc
cccatctgccaaaccaccatggccttccttcgagatgaggcagacttccgggacaagctg
agccccattgtgctcagcctcaacgtgtccctgccctccaaggaggctggaatagcccct
gctgtcatgctgcatggagacacccacgtgcaggagcagacgagaatcatcctggactgc
ggggaagatgacgtgtgtgtgccccagcttcagctcactgccaacatgaccggctcccca
ctcctagttggagcagataacgtcctggagctgcagatggacgcagccaacaagggcgag
ggggcctatgaagcagagctcactgtgcacctgccccagggggcccactacatgcgggcc
ctcagcaacgtcgagggctttgagagactcatctgtaatcagaagaaggagaatgagacc
agcgtggtactgtgtgagctgggcaaccccatgaagaagaacgctcagataggaatcgcg
atgttattgagtgtggggaatctggaagaggctgtagagtctgtgtccttccagctgcag
atccggagcaagaacagccagaatccaaacagcaagatggtgctgctggaggtgccagtc
tgggcagaggcccaagtggagcttcgagggaactcctttccagcctccctggtgctggcg
gcagaagaaggtgataaggagcagaacagcttggtcagctggggacccaaagtggagcac
acctatgagctccacaacaatggccctgggactgtgaaaggccttcgcctccgcatccac
ctccctgggcagtcccagccctcagacctgctctacatcctggatctacagccccagggg
ggccttcagtgctccccacagcctcccatcaaccccctccaggtggactgggggctgccc
accaccagcccctcctccatccacccggctcatcacaagcgggatcgcagacagatcgtc
ctaccagagcctgggcagccctcaaggcttcaggatcccattctcgtgagctgcgactca
gagacctgtactgtggtggagtgtgacctgcaggagatggcgcgcgggcagcgggccatg
gtcaccatactggccttcctgtggctccccagcctccgccagaggccactggatcagttt
gtgctgcagtcgcacgcatggttcaacgtgtcctccctcccctacgctgtgcccccgctc
agcctgccccgaggggaagctcaggttcggactcagctgctccgggccttggaggagagg
gccattccgatctggtgggtgccggtaggcgtgctgggtggcctgctgctgctcaccctc
cttgttctggccatgtggaaggttggcttcttcaagcggaaacggccacccctggaagaa
gatgatgaagaggaggagtga

DBGET integrated database retrieval system