KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386743Help
Entry
100386743         CDS       T03264                                 

Gene name
KCNJ14
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 14
  KO
K05007  potassium inwardly-rectifying channel subfamily J member 14
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04725  Cholinergic synapse
cjc04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100386743 (KCNJ14)
  09156 Nervous system
   04725 Cholinergic synapse
    100386743 (KCNJ14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100386743 (KCNJ14)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100386743 (KCNJ14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 100386743
NCBI-ProteinID: XP_002762370
Ensembl: ENSCJAG00000000396
UniProt: F6Q9X4
Position
22
AA seq 436 aa AA seqDB search
MGLARALRRLSGVLDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDEAEGGNGEETEDGA
TSPRVLTPTLTLTLPP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggccagggccctacgccgccttagcggcgtcctggattctggggacagccgg
gctggcgatgaagaggaggccggaccagggctgtgccgcaacgggtgggcgccagcgccg
gtgcagtcaccggtgggccggcgccgcggtcgcttcgtcaagaaggacgggcactgcaac
gtgcgcttcgtgaacctgggcggccagggcgcgcgctacctgagcgacctgttcaccacg
tgcgtggacgtgcgctggcgctggatgtgcctgctgttctcctgctccttcctcgcctcc
tggctgctctttggcctggccttctggctcattgcctcgctgcacggcgacctggccgcc
ccgccaccgcccgcgccctgcttctcgcacgtggccagcttcctggccgccttcctcttc
gcgctggagacgcagacgtccatcggctacggcgtgcgcagcgtcaccgaggagtgcccg
gccgccgtggccgccgtggtgctgcagtgcatcgccggctgcgtgctcgacgccttcgtc
gtgggcgccgtcatggccaagatggccaaacccaagaagcgcaacgagacgctggtcttc
agcgagaacgccgtcgtggcgctgcgcgaccaccgcctctgcctcatgtggcgcgtcggc
aacctgcgccgcagccacctggtggaggcccacgtgcgggcccagctgctgcagcctcgt
gtgaccccagagggtgagtacatccctctggaccaccaggatgtggacgtgggctttgat
ggaggcaccgatcgtatcttcctcgtgtcccccatcaccatcgtccatgagatcgactcg
gccagtcctctgtatgagctaggacgcgctgagctggccagggctgacttcgagctggtg
gtcattctcgaggggatggttgaggccacagccatgaccacacagtgtcgctcatcctac
ctccctggtgaactgctctggggccatcgttttgagccagttctcttccagcgtggctcc
cagtatgaggttgactatcgacacttccaccgcacttacgaggtcccagggacgccggtc
tgcagtgctaaggagctggatgaacgggcggagcaggcttcccacagcctcaagtctagc
ttccccggctctctgactgcattttgttatgagaatgaacttgctctgagctgctgccag
gaggaagatgaggacgatgaggccgagggagggaatggggaggagacagaagatggggct
accagcccccgagttctcacaccgaccctgacgctgaccctgcctccgtga

DBGET integrated database retrieval system