KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386750Help
Entry
100386750         CDS       T03264                                 

Gene name
BRIP1
Definition
(RefSeq) BRCA1 interacting protein C-terminal helicase 1
  KO
K15362  fanconi anemia group J protein [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100386750 (BRIP1)
   03460 Fanconi anemia pathway
    100386750 (BRIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100386750 (BRIP1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100386750 (BRIP1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     100386750 (BRIP1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100386750 (BRIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C_2 DEAD_2 DEAD ResIII SNF2_N HBB DUF1866
Motif
Other DBs
NCBI-GeneID: 100386750
NCBI-ProteinID: XP_002806878
Ensembl: ENSCJAG00000001292
Position
5
AA seq 1252 aa AA seqDB search
MSAMWSEYTISGVKINFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSA
LAWQQSLSGKPADEGISEKAEVPLSCCCTCHSKDFTNNDMNQGTSHHFNNPSTPPSERNE
TPSACQDSPAKTTLAAKLSAKKQASVYRDENDDFQVEKKRIRPLETAQQIRKRHCFGTEV
HNSDAKLDSGKTIKRNSPLGKINSLSPQKPPRHCSWCCCSTKQGNSQESLNTIKKDHTGK
SKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCME
LLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLRACPYYTARELIQ
DADIIFCPYNYLLDAQIRETMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARD
ELDSMVNNNVRKKDHEPLRAVCYSLINWLEANSEYLVERDYESSCKIWSGNEMLLNLHKM
GITTATFPILQGHFSAVLQKEEKIPPIYGKEEAIEVPIISASTQIMLKGLFMVLDYLFRQ
NSRFADDYKIAIQQTYSWTNQVDISDKNGWLVLPKNKKRSRQKTAVHVLNFWCLNPAVAF
SDINGKVRTIVLTSGTLSPMKSFSSELGVTFTIQLEANHVIKNSQVWVGTVGSGPKGRNL
CATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHKLELV
KTVIVEPQGGEKTDFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVI
TIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWG
ALILVDDRFRNNPGRYISGLSKWIRQQIQHHSTFESALESLAEFSKRRQKVLDVSIKDRA
NIQDNGSTLEVTSLMDSTPTYLLEAASHLSPENFVKDEAKMCVQELQCPEIITKNSPLPS
GIISRKERNDPVFLEEPVQAMKAEKIVISRSTSPTFNKQTNRVTWSSFNSLGQYFTGKIP
KSTPELRSSKNIASSPPSFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSL
KIDGTLIXKNHPEYPLCSEEALDPDIELSLVSEEDKQSTSNRDFDTEAEDESIYFTPELY
DPEDTNEEKNDQVETDRGNRLANNSDCILAEDLFEIRTIKEIDSAREVKAEDCTDTKLNG
ILHIEENKIDDIDGNVKTTWINELELGNTHEIEIKNFKPSPSKNKGMFHSFK
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaatgtggtctgaatatacaattagcggggtgaagattaactttccttataaa
gcttacccatcacagcttgctatgatgaattctattctcagaggattaaacagtaagcag
cattgtttattggagagtcccacaggaagtggaaaaagcttagccttactttgttctgct
ttagcatggcaacagtcccttagtgggaagccagcagatgagggcataagtgaaaaagct
gaagtaccattgtcatgttgttgtacatgccattcaaaggattttacaaacaatgatatg
aaccaaggaacttcacatcatttcaacaatccaagcacaccaccttctgaaagaaatgag
actccatcagcttgtcaagactcccctgcaaaaaccaccctggctgccaagttatctgct
aagaaacaggcatccgtatacagagatgaaaatgatgattttcaagtagagaagaaaaga
attcgacccttagaaactgcacagcagattagaaaacgtcattgctttggaacagaagta
cacaattcggatgcaaaacttgattcaggaaagaccataaaacgcaactctccattggga
aagataaactccttgtctccacaaaaaccccctcgccactgttcgtggtgctgttgttct
actaaacaaggaaacagtcaagagtcattgaataccattaagaaagatcacacggggaaa
tccaagatacccaaaatatattttgggacgcgcacacacaagcagattgctcagattact
agagagctccggaggacggcatattcaggggtcccaatgactattctttccagcagggat
catacttgtgtccatcctgaagtagttggtaacttcaacagaaatgaaaagtgcatggaa
ttgctggatgggaaaaatggaaaatcctgctatttttatcatggagttcataaaattagt
gatcagcacacattacagactttccaagggatgtgtaaagcctgggatatagaagagctt
gtcagcttagggaagaaactaagggcctgtccatattacacagcccgagaactaatacaa
gatgctgacatcatattttgtccctacaactatcttctagatgcacaaataagggaaacc
atggatttaaatctgaaagagcaggttgtcattttagatgaagctcataacatcgaggac
tgtgctcgggaatcagcaagctacagtgtaacagaagttcagcttcgatttgctcgggat
gaactagatagtatggtcaacaataatgtaaggaaaaaagatcatgaacccctacgagct
gtgtgctatagcctcattaattggttagaagcaaactctgaatatcttgtagaaagagat
tatgaatcatcttgtaaaatatggagtggaaatgaaatgctcttaaatttgcacaaaatg
ggcattaccactgctacttttcccattttgcagggccatttttctgctgttcttcagaaa
gaggaaaaaatcccaccaatttatggtaaagaggaagcaatagaagtgccaattattagt
gcatcaactcaaataatgcttaaaggactttttatggttcttgactacctttttaggcaa
aacagcagatttgcggatgattataaaattgctattcaacagacttattcatggacaaat
caggttgatatttcagataaaaatgggtggttggttctaccaaaaaataagaaacgttca
cgacagaagactgcagttcatgtgctcaacttttggtgcttaaatccagctgtggccttt
tcagatattaatggcaaagttcggactattgttttgacatccggtacattatcaccaatg
aaatccttttcgtcagaacttggggttacatttaccatccagctggaggctaatcatgtc
attaaaaattcacaggtttgggttggtaccgttggatcaggccccaagggtcggaatctc
tgtgctaccttccaaaatactgaaacatttgagttccaagatgaagtgggagcactttta
ttatctgtgtgccagactgtgagccaaggaattttgtgttttttgccatcttacaagtta
ttagaaaaattgaaagaacgttggctctctactggcttatggcataaactggagttggtg
aagacagtcattgtagaaccacagggaggagaaaaaacagattttgatgaattactgcag
gtgtactatgatgcaatcaaatacaaaggagagaaagatggagccctcctggtagcagtt
tgtcgtggtaaagtgagtgagggtctggatttctcagatgacaatgcccgtgctgtcata
acaataggaattccttttccaaatgtgaaagatctacaggttgaactaaaacgacaatac
aatgaccaccattcaaaattgagaggtcttttacctggccgtcagtggtatgaaattcaa
gcatacagggccttaaaccaggcccttggtagatgtattcgacacagaaatgattgggga
gctcttattctagtggatgatcgttttaggaataacccaggtcgctatatatctggactt
tctaaatggatacggcagcagattcagcatcattcaaccttcgaaagtgccctggagtcc
ttggccgaattttccaaaaggcgtcaaaaagttcttgatgtatccataaaggacagagca
aatatacaggacaatgggtccacacttgaagtgacctctttaatggacagtaccccaact
tatttattggaagcagcaagtcatctatcaccagaaaattttgtgaaagatgaagcaaag
atgtgtgtccaggaactacagtgtcctgaaatcattactaaaaattcacctctaccaagt
ggcatcatctccagaaaggagagaaatgatccagtattcctggaagagcctgtccaagca
atgaaagcagaaaaaattgtgatttccagatccacaagcccaacttttaacaaacaaaca
aacagagttacttggtccagctttaattctttgggacagtattttactggtaaaatacca
aagtcaacacctgagctcaggtcatcaaagaatattgcctcaagtcctcccagtttcaaa
acagaaaagatggaaagtaaaactgttttgccattcactgataaatgtgaatcctcaaat
ctgacagtaaacacatcatttggatcatgccctcagtcagaaaccattatttcatcatta
aagattgatggaacccttattnagaaaaatcatcccgaatatcctctctgttctgaagaa
gccctagatccagacattgaattgtctctagtaagtgaagaagataaacaatccacttca
aatagagattttgacacagaagcagaagatgaatctatctattttacacctgaactttat
gatcctgaagacacaaatgaagaaaaaaatgaccaagtcgaaactgatagaggaaacaga
ttggctaacaattcagattgcattttagctgaagacctttttgaaattagaactataaaa
gaaatagattcagccagagaagtgaaagctgaggattgcacagatacaaagttgaatgga
attctgcatattgaagaaaataaaattgatgacattgatggtaatgtaaaaacaacttgg
ataaatgaattggaactgggaaacactcatgaaatagaaataaagaactttaaaccatct
ccttccaaaaataaaggtatgtttcatagttttaagtaa

DBGET integrated database retrieval system