KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386848Help
Entry
100386848         CDS       T03264                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc04940  Type I diabetes mellitus
cjc05142  Chagas disease (American trypanosomiasis)
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05320  Autoimmune thyroid disease
cjc05321  Inflammatory bowel disease (IBD)
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100386848 (IL2)
   04151 PI3K-Akt signaling pathway
    100386848 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100386848 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100386848 (IL2)
   04660 T cell receptor signaling pathway
    100386848 (IL2)
   04658 Th1 and Th2 cell differentiation
    100386848 (IL2)
   04659 Th17 cell differentiation
    100386848 (IL2)
   04672 Intestinal immune network for IgA production
    100386848 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100386848 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100386848 (IL2)
   05321 Inflammatory bowel disease (IBD)
    100386848 (IL2)
   05330 Allograft rejection
    100386848 (IL2)
   05332 Graft-versus-host disease
    100386848 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100386848 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386848 (IL2)
   05162 Measles
    100386848 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100386848 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100386848 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100386848 (IL2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100386848 (IL2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100386848 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2 Plasmid_RAQPRD
Motif
Other DBs
NCBI-GeneID: 100386848
NCBI-ProteinID: XP_002745478
Ensembl: ENSCJAG00000002770
UniProt: Q0PIT4
Position
3
AA seq 154 aa AA seqDB search
MYRMQLLSCIALSLALITNSAPTSSSTKKTQLQLEHLLLDLQMLLNGINNYKNPKLTRML
TFKFYMPKKAKELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTRDIISNINVLVLELKGS
ETTFTCEYDDDTATIIEFLNGWITFCQSIISTLT
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcactcatcacaaacagt
gcacctacttcaagttctacaaagaagacacagctacaactggagcatttactgctggac
ttacagatgcttttgaatggaattaataattacaagaatcccaaactcacaaggatgctc
acatttaagttttacatgcccaagaaggccaaagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagacaccagggatataatcagcaatatcaatgtactagttttggaactaaagggatct
gaaacaacattcacatgtgaatatgatgatgacacagcaaccattatagaatttctgaat
ggatggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system