KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386851Help
Entry
100386851         CDS       T03264                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03320  PPAR signaling pathway
cjc04659  Th17 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05216  Thyroid cancer
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100386851 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100386851 (RXRG)
   03320 PPAR signaling pathway
    100386851 (RXRG)
   04919 Thyroid hormone signaling pathway
    100386851 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100386851 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100386851 (RXRG)
   05202 Transcriptional misregulation in cancer
    100386851 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    100386851 (RXRG)
   05216 Thyroid cancer
    100386851 (RXRG)
   05222 Small cell lung cancer
    100386851 (RXRG)
   05223 Non-small cell lung cancer
    100386851 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100386851 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100386851 (RXRG)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100386851 (RXRG)
Nuclear receptors [BR:cjc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100386851 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 100386851
NCBI-ProteinID: XP_002760488
Ensembl: ENSCJAG00000004656
UniProt: U3FF43
Position
18
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHSSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPTGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLAGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASNGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccgtcggcagccttgtccacggggaaaccaatggac
agccattccagctacacggacaccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacctctgccatgggcccaccc
acaggagcactggcagcccctccaggaatcaacctggttgccccacccagctctcagcta
aatgtggtcaacagtgtcagcagttcagaggacatcaaacccttagcagggcttcctggg
attggaaacatgaactacccgtccaccagccctggatcgctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactacggagtgtacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacatgtcgggataataaagat
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgggagcgagct
gagagtgaggcagaatgtgccagtaatggtcatgaagacatgcccgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaacatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgcggctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ctgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccaccggagcagtgcccatagt
gctggggtcggctccatctttgacagagttctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagctattgtgctctttaacccagat
gccaagggcctctccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
cttgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgctccattggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgctg
cagatcacttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407498Help
Entry
100407498         CDS       T03264                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03320  PPAR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04659  Th17 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04976  Bile secretion
cjc05160  Hepatitis C
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05216  Thyroid cancer
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100407498 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100407498 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100407498 (RXRA)
   03320 PPAR signaling pathway
    100407498 (RXRA)
   04919 Thyroid hormone signaling pathway
    100407498 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    100407498 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    100407498 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407498 (RXRA)
   05202 Transcriptional misregulation in cancer
    100407498 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    100407498 (RXRA)
   05216 Thyroid cancer
    100407498 (RXRA)
   05222 Small cell lung cancer
    100407498 (RXRA)
   05223 Non-small cell lung cancer
    100407498 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100407498 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100407498 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100407498 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100407498 (RXRA)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100407498 (RXRA)
Nuclear receptors [BR:cjc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100407498 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 100407498
NCBI-ProteinID: XP_009003369
Ensembl: ENSCJAG00000010148
UniProt: U3F0V7
Position
1
AA seq 462 aa AA seqDB search
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPATPTLGFSTGNPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANVGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKQKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgatttctccacccaggtgaactcgtccctcacc
tccccaacaggccgaggctccatggctgccccctcgctgcacccgtccctggggcctggc
attggctccccagggcagctgcactcccccatcagcaccctgagctcccccatcaatggc
atgggtccgcccttctctgtcatcagctcccccatgggcccgcactccatgtcggtgcct
gccacacccaccctgggcttcagcactggcaacccccagctcagctcacccatgaacccc
gtcagcagcagcgaggacatcaagcctcccctgggcctcaatggcgtcctcaaggtccct
gcccacccctcaggaaacatggcatccttcaccaagcacatctgcgccatctgcggggac
cgctcctcaggcaagcactacggcgtgtacagctgtgagggctgcaagggcttcttcaag
cggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgcctgattgac
aagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatg
aagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgagaatgaggtg
gagtcgaccagcagcgccaacgaggacatgcctgtggagaggatcctggaggctgagctg
gctgtggagcccaagaccgagacctacgtggaggccaacgtggggctgaaccccagctca
ccgaacgaccccgtcaccaacatctgccaagcagccgacaagcagctcttcaccctggtg
gagtgggccaagcgcatcccgcacttctcagagctgcccctggacgaccaggtcatcctg
ctgcgggcaggctggaacgagctgctcatcgcctccttctcccaccgctccatcgccgtg
aaggatgggatcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgca
ggggtgggcgccatctttgacagggtgctgacggagctcgtgtccaagatgcgggacatg
cagatggacaagacggagctgggctgcctgcgcgccatcgtcctcttcaaccctgactcc
aaggggctctcgaacccggccgaggtggaggcgctaagggagaaggtctatgcatccctg
gaggcctactgcaagcagaagtacccagagcagccgggaaggttcgccaagctcttgctc
cgcctgccggctctgcgctccattgggctcaagtgcctggaacatctcttcttcttcaag
ctcattggggacacgcccatcgacaccttcctcatggagatgctggaagccccacaccaa
atgacttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414004Help
Entry
100414004         CDS       T03264                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03320  PPAR signaling pathway
cjc04659  Th17 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05216  Thyroid cancer
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100414004 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100414004 (RXRB)
   03320 PPAR signaling pathway
    100414004 (RXRB)
   04919 Thyroid hormone signaling pathway
    100414004 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100414004 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414004 (RXRB)
   05202 Transcriptional misregulation in cancer
    100414004 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100414004 (RXRB)
   05216 Thyroid cancer
    100414004 (RXRB)
   05222 Small cell lung cancer
    100414004 (RXRB)
   05223 Non-small cell lung cancer
    100414004 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100414004 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100414004 (RXRB)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100414004 (RXRB)
Nuclear receptors [BR:cjc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100414004 (RXRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 100414004
NCBI-ProteinID: XP_002746468
Ensembl: ENSCJAG00000021619
Position
4
AA seq 532 aa AA seqDB search
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAGGKQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggccgctcgcccgcccttcctccctcagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcggcaggcggaaaacaacaaaccccg
gaaccggagccgggggaggccggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagctcctccccaaatccccttccccagggagtccctcccccttctcctcct
gggccacccctacccccttcaacagctccatcccttggaggctctggggccccaccccca
cccccgatgccaccacccccactgggctctccctttccagttatcagttcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagcccccag
attaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggcccgggggctggc
aaacggctatgtgcaatctgcggggacagaagctcaggcaaacactacggggtttacagc
tgtgagggttgcaagggcttcttcaaacgcaccatccgaaaggaccttacgtactcttgc
cgggacaacaaagactgcacagtagacaagcgccagcggaaccgctgtcagtactgccgc
taccagaagtgcctggccactggcatgaagagggaggcggtacaggaggagcgtcagcgg
ggaaaggacaaggatggggatggggagggggctgggggagcccctgaggagatgcctgtg
gacaggatcctggaggcagagcttgctgtggagcagaagagtgaccagggcgttgagggt
cctgggggaaccggtggtagcggcagcagcccaaatgaccccgtgactaacatctgtcag
gcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatcccacacttttcc
tccttgcctctggatgatcaggtcatattgctgcgggcaggctggaacgaactcctcatt
gcttccttctcccaccgatccattgatgttcgagatggcatcctccttgccacaggtctt
catgtgcaccgaaactcagcccattcagcaggagtaggagccatctttgatcgggtgctg
acagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctg
agggcaatcattctgtttaatccagatgccaagggcctctccaaccctagtgaggtggag
gtcctgcgggagaaagtgtatgcatcactggagacctactgcaaacagaagtaccctgag
cagcagggacggtttgccaagctgctgctacgtcttcctgccctccggtccatcggcctt
aagtgtctagagcatctgtttttcttcaagctcattggtgacacccccatcgacactttt
cttatggagatgcttgaggctccccatcaactggcctga

DBGET integrated database retrieval system