KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386921Help
Entry
100386921         CDS       T03264                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04062  Chemokine signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100386921 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100386921 (PLCB2)
   04310 Wnt signaling pathway
    100386921 (PLCB2)
   04371 Apelin signaling pathway
    100386921 (PLCB2)
   04020 Calcium signaling pathway
    100386921 (PLCB2)
   04070 Phosphatidylinositol signaling system
    100386921 (PLCB2)
   04072 Phospholipase D signaling pathway
    100386921 (PLCB2)
   04071 Sphingolipid signaling pathway
    100386921 (PLCB2)
   04022 cGMP-PKG signaling pathway
    100386921 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100386921 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100386921 (PLCB2)
   04621 NOD-like receptor signaling pathway
    100386921 (PLCB2)
   04062 Chemokine signaling pathway
    100386921 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    100386921 (PLCB2)
   04922 Glucagon signaling pathway
    100386921 (PLCB2)
   04912 GnRH signaling pathway
    100386921 (PLCB2)
   04915 Estrogen signaling pathway
    100386921 (PLCB2)
   04921 Oxytocin signaling pathway
    100386921 (PLCB2)
   04926 Relaxin signaling pathway
    100386921 (PLCB2)
   04918 Thyroid hormone synthesis
    100386921 (PLCB2)
   04919 Thyroid hormone signaling pathway
    100386921 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100386921 (PLCB2)
   04916 Melanogenesis
    100386921 (PLCB2)
   04924 Renin secretion
    100386921 (PLCB2)
   04925 Aldosterone synthesis and secretion
    100386921 (PLCB2)
   04927 Cortisol synthesis and secretion
    100386921 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100386921 (PLCB2)
   04270 Vascular smooth muscle contraction
    100386921 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    100386921 (PLCB2)
   04971 Gastric acid secretion
    100386921 (PLCB2)
   04972 Pancreatic secretion
    100386921 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100386921 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100386921 (PLCB2)
   04725 Cholinergic synapse
    100386921 (PLCB2)
   04728 Dopaminergic synapse
    100386921 (PLCB2)
   04726 Serotonergic synapse
    100386921 (PLCB2)
   04720 Long-term potentiation
    100386921 (PLCB2)
   04730 Long-term depression
    100386921 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    100386921 (PLCB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100386921 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100386921 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100386921 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100386921 (PLCB2)
   05016 Huntington disease
    100386921 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100386921 (PLCB2)
   04934 Cushing syndrome
    100386921 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100386921 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100386921 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    100386921 (PLCB2)
   05143 African trypanosomiasis
    100386921 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100386921 (PLCB2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100386921 (PLCB2)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100386921 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100386921 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 UvrD-helicase MMACHC
Motif
Other DBs
NCBI-GeneID: 100386921
NCBI-ProteinID: XP_002753596
Ensembl: ENSCJAG00000020865
Position
10
AA seq 1185 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVAAPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKALTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANAPRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPETVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKDH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLDHDKLLLHHDMAQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEALRGKILIKNKKNQFSGSTSSSKEPGGE
AEGSSPPNAPAGEGTVWAVEEGTELEEEEVEEEEEEASGSLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFAAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYPPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEAPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLRSESNMPLTMPALFVYLEMKDYVPGAWADLTVALANPIKFFNAHDKKSVKLKEAMGGL
PEKPFPLASPVASQVNEALAPTTNGSVAARVGAREEPMKAAAEPRTASLEELRELKGVVK
LQRRHEKELQELERRGTRRWEELLQRGVAQLAELGPPGAGGGVACKLGPGKGSHKKRSLP
CGESTGAAPGKCPEGVEARVRELKDRLELELLRLGEEQYECVLKLKEQQVAEQISKMMQL
AREKQVAELKALKETSEIDTKEMKKKLETKRLEQIQAMTKTTTDKMAQERLKREINNSHI
QEVVRVIKQMTESLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAETKE
SVRSCLKTCFPSEAKDKPERACESPRELCEQDPLVAKADAQESRL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctgaatcctgtcctgctgcccccgaaggtgaaggcctatctgagccagggg
gagcgcttcatcaaatgggatgatgaaactacagttgccgctccagttatactccgtgtg
gaccctaagggctactacttatactggacatatcaaagtaaggagatggagtttctggat
atcaccagcatccgggacacccgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagcttcctgctaaaggcactcacg
gtggtgtctggcccagacatggtggacctcaccttccacaacttcgtttcctacaaggag
aatgtgggcaaggtctgggctgaggacgtactggccttagtcaagcatccactaacagcc
aacgccccccgcagcaccttcctggacaagatcctcgtgaagctcaagatgcagctcaac
tcagaagggaagattcctgtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaagaatgacgccatcaatcct
gaggacttcccagaaactgtctacaagagtttcctcatgagcctgtgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggctaaaccctacatgacaaaggaccac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctattccca
ccagcacggcctgaccaggtgcagggtctcatcgacaagtatgagcccagtggcatcaat
gtacagaggggccagctgtcacctgagggcatggtctggtttctctgcgggccagagaac
agtgtgctggaccacgacaagctgctgctccaccacgacatggcacagccactcaatcat
tacttcatcaactcctcccacaacacctacctgacagctggccagttctcgggcctctcc
tcggctgagatgtaccgccaggtgctgctgtctggctgccgttgtgtggagctagactgc
tggaagggaaaaccccctgacgaggagcccatcatcacccatggctttaccatgaccaca
gacatcttcttcaaggaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gccgagtactgccggactatctttggggacatgctgctcacagagcccctggaaaagttc
ccattgaaaccaggcgtccccctgcccagccctgaggctctcaggggcaagatcctcatc
aagaacaagaagaaccagttttccggttccacctcctccagtaaggagcctggtggggag
gctgagggcagcagcccacccaatgcccctgcgggtgagggcacagtgtgggctgtcgag
gaagggactgagctggaggaggaggaggtagaagaggaagaggaggaggcatcgggaagc
ctggatgaagaagagataaagaagatgcagtcggatgagggcacagcaggcctggaagtg
acggcttacgaggagatgtccagcctagtcaattacattcagcccaccaagttcatctcc
tttgagttcgctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctgtccaaggcctcagtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacccgccccagatgttc
tggaatgctgggtgccagatggttgccctcaacttccagacgatggacttgcccatgcaa
cagaacatggcagtgtttgagttcaacgggcagagtggctacctcctcaagcacgagttc
atgcgcaggccagacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccatcacggtaatctctgggcagttcctgtcagaacgcagtgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtaccaattccatcaaccctgtctggaaggaggcgccctttgtcttt
gagaagatcttgatgcctgagctggcctctctcagggtggctgtgatggaggaaggcaac
aagtttcttggacaccgtattatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcgcagcgagagcaacatgcccctgaccatgcctgcactcttcgtctatctggag
atgaaggactacgtacctggtgcctgggcagatctcactgtggcccttgccaatcccatc
aagttcttcaatgcccatgacaagaagtccgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatgaggcgttggcc
ccaacgaccaatgggtcagtagcagccagggtcggggccagggaggagcccatgaaagca
gctgcggagccgcggactgccagcctggaggagctccgggagctgaagggcgtcgtgaag
ctgcagcggcggcacgagaaggagctgcaggagttggagcggcgcggcacgcggcgctgg
gaggagctgctgcagcggggcgtggcgcagctggccgagttggggccgccgggcgcgggt
ggtggcgtggcctgcaagctcggcccgggcaagggctctcacaagaagaggagcctgccc
tgcggggagagcactggagctgcgcccggcaagtgccctgagggtgtggaggcgcgggtg
cgggagctgaaggacaggctggagctggagctgctgcggctgggcgaggagcagtacgag
tgcgttctgaagctcaaggagcagcaagtggccgagcaaatctccaaaatgatgcagctg
gccagagagaaacaagtggcagagctgaaggccctgaaagagacttcggagatcgacacc
aaagagatgaagaaaaagctggagaccaagagactggagcagatccaggccatgaccaaa
accaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcgggtgatcaagcagatgacggagagcttggagaggcaccaggagaag
ctggaggagaagcaggcggcctgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcactggcagagtacgaggccaggatgaagggtctggaggcagagacgaaggag
tcagtgaggtcctgcctcaagacctgcttcccctctgaggccaaagacaagcctgagagg
gcctgcgagtcccccagagaactgtgtgagcaggacccacttgtagcaaaggcagatgcc
caagagagccgcctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400803Help
Entry
100400803         CDS       T03264                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04062  Chemokine signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100400803 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100400803 (PLCB3)
   04310 Wnt signaling pathway
    100400803 (PLCB3)
   04371 Apelin signaling pathway
    100400803 (PLCB3)
   04020 Calcium signaling pathway
    100400803 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100400803 (PLCB3)
   04072 Phospholipase D signaling pathway
    100400803 (PLCB3)
   04071 Sphingolipid signaling pathway
    100400803 (PLCB3)
   04022 cGMP-PKG signaling pathway
    100400803 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100400803 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100400803 (PLCB3)
   04621 NOD-like receptor signaling pathway
    100400803 (PLCB3)
   04062 Chemokine signaling pathway
    100400803 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    100400803 (PLCB3)
   04922 Glucagon signaling pathway
    100400803 (PLCB3)
   04912 GnRH signaling pathway
    100400803 (PLCB3)
   04915 Estrogen signaling pathway
    100400803 (PLCB3)
   04921 Oxytocin signaling pathway
    100400803 (PLCB3)
   04926 Relaxin signaling pathway
    100400803 (PLCB3)
   04918 Thyroid hormone synthesis
    100400803 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100400803 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100400803 (PLCB3)
   04916 Melanogenesis
    100400803 (PLCB3)
   04924 Renin secretion
    100400803 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100400803 (PLCB3)
   04927 Cortisol synthesis and secretion
    100400803 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100400803 (PLCB3)
   04270 Vascular smooth muscle contraction
    100400803 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    100400803 (PLCB3)
   04971 Gastric acid secretion
    100400803 (PLCB3)
   04972 Pancreatic secretion
    100400803 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100400803 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100400803 (PLCB3)
   04725 Cholinergic synapse
    100400803 (PLCB3)
   04728 Dopaminergic synapse
    100400803 (PLCB3)
   04726 Serotonergic synapse
    100400803 (PLCB3)
   04720 Long-term potentiation
    100400803 (PLCB3)
   04730 Long-term depression
    100400803 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100400803 (PLCB3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100400803 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100400803 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400803 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100400803 (PLCB3)
   05016 Huntington disease
    100400803 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100400803 (PLCB3)
   04934 Cushing syndrome
    100400803 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100400803 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100400803 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    100400803 (PLCB3)
   05143 African trypanosomiasis
    100400803 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100400803 (PLCB3)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100400803 (PLCB3)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100400803 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100400803 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Motif
Other DBs
NCBI-GeneID: 100400803
NCBI-ProteinID: XP_017833718
Ensembl: ENSCJAG00000018081
UniProt: U3BBD1
Position
11
AA seq 1233 aa AA seqDB search
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGGPDN
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEERVLEKPSLELRKSLGE
EGLNRGPYALGPADREDEEEDEDEEEQSDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FAFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGYETCQDTQSQQL
GSQLSPNPSPSPLDASPRRPPGPATSPTSASLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERELRELRKKHQRKVVTLTRRLLDGLAQAQAESRCRPRPGALGRAADEDS
KEGEDEVKRYQEFQNRQVQSLLELREAQADTEAQRRLEHLKQAQQRLREVVLDANTTQFK
RLKETNEREKKELQKILDRKRHNSISEAKTRDKHKKEVELTEINRRHITESVNSIRRLEE
AQKQRHDRLEAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGETSEGLGD
RPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctctagtcggaacctg
gtcaccctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtagacacactggacatcagttccatcagggacacacggacgggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagaccccgtaaacacagtgttcttgaacttc
atggccgtgcaggacgacacagccaaggtctggtccgaggagctgttcaagctggcgatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gctgacaagaagcgagtggagactgcgctggaatcctgtggcctcaacttcaaccggagt
gagtccatccggcccgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggtgccaagggcaagccgtac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccacccctgcggccctcccaagcccggctgctcattgagaagtatgag
cccaacaagcagtttctggagcgagaccagatgtccatggagggctttagccgctatctg
ggaggtgaggagaacggcatcctgcccctggaagccctggatctgagcgcagacatgacc
cagccgctgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacgtcgtcagtggagatgtaccgccaggccctgctctggggctgccgctgt
gtggagctggacgtgtggaaggggcggccgcccgaggaggagcccttcatcacccatggc
ttcaccatgaccacggaggtgcctctgcgagacgtgctggaggccattgctgagaccgcc
ttcaagacctcgccctaccctgtcatcctctcctttgagaaccacgtggactcggcaaag
cagcaggcaaagatggccgagtactgccgctccatttttggagatgcactgcttatcgac
cctctggacaagtacccgctggccccaggcgtccccttgcccagcccccaggacctgatg
ggccgaatcctggtgaagaataagaagcggcaccagcctagcacgggtggcccagacaac
gccgggcgcaagcggccgctggagcagagcaactcggccctgagtgagagttctgccgcc
accgagccctcctccccgcagcttgggtctcccagctctgatagctgcccaggcctgagc
aatggggaggagcgggtgctcgagaagcccagcctggagcttcgaaaatctttgggcgag
gagggcctgaaccggggcccctatgctcttggacctgctgaccgtgaggatgaggaggaa
gacgaggacgaagaggaacagtcagaccccaaaaagcccaccacagatgagggcacagcc
agcagcgaggtcaatgccaccgaggagatgtccacgcttgtcaactacattgagcctgtc
aagttcaagtcttttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcagctaaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgtgtggactcctccaactatatg
ccccagctcttctggaacgtggggtgccagcttgttgcactcaacttccagaccctggat
gtggcgatgcagcttaacgcgggcgtgttcgagtacaacgggcgcagcgggtacctgctc
aagccagagttcatgcggcggccggacaagtccttcgaccccttcactgaagtcatcgtg
gatggcattgtagccaatgccttgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggcatctatgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactccttcaaccctgtgtgggacgaggagccg
tttgccttccccaaggtggtgctgcccacgctggcttcgcttcgcatcgcagcctttgag
gagggcggcaaatttgtggggcaccggatcctgcctgtctctgccatccgctccgggtac
cactatgtctgcctgcggaacgaggccaaccaaccgctgtgtctgccggccctactcatc
tacaccgaggcctcggactacattcctgatgaccaccaggactacgcggaggccttgatc
aaccccattaagcacgtcagcctgatggaccagagggcccgccaactggctgccctcatt
ggtgagagtgaggctcaggctggctatgagacatgccaagacacccagtctcagcagctg
gggtctcagctgtccccaaaccccagccctagcccactcgatgcctccccacgccggccc
cctggccctgccacctcccctaccagcgcctctctgagcagcccagggcagcgcgatgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggacgagctccgaggacac
aaggctctggtcaagctccggagccggcaggagcgagagcttcgggagctgcgcaagaag
catcagcggaaggtggtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gcggagagcaggtgccggccacggccaggtgccctaggtcgggccgctgacgaggactca
aaggagggggaggatgaggtgaagcgctatcaggagttccagaacagacaggtgcagagc
ctgctggagctgcgggaggcccaggcagacacggaggcccagcggaggctggagcatctg
aaacaggctcagcagcggctcagggaggtcgtccttgatgcaaacacaactcagttcaag
aggctgaaggagacgaacgagagggagaagaaggagctgcagaagatcctggacagaaag
cgccacaacagcatctcggaggccaagacgcgggacaagcataagaaggaggtggaactg
acagagattaatcgtcggcatatcactgagtctgtcaactccatccgtcggctggaggag
gcccagaagcagcggcacgaccgtcttgaggcagggcagcagcaggtcctgcaacagctg
gcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgggcg
aggctgccccaggagatccgccggagcctgctgggcgagacgtcggaggggctgggggac
aggcctctggtggcctgtgccagcaacggtcacgcacctgggagcagtgggcacctgtcg
ggcgctgactcggagagccaggaggagaacacgcagctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409716Help
Entry
100409716         CDS       T03264                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04062  Chemokine signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100409716 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100409716 (PLCB1)
   04310 Wnt signaling pathway
    100409716 (PLCB1)
   04371 Apelin signaling pathway
    100409716 (PLCB1)
   04020 Calcium signaling pathway
    100409716 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100409716 (PLCB1)
   04072 Phospholipase D signaling pathway
    100409716 (PLCB1)
   04071 Sphingolipid signaling pathway
    100409716 (PLCB1)
   04022 cGMP-PKG signaling pathway
    100409716 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100409716 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100409716 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100409716 (PLCB1)
   04062 Chemokine signaling pathway
    100409716 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    100409716 (PLCB1)
   04922 Glucagon signaling pathway
    100409716 (PLCB1)
   04912 GnRH signaling pathway
    100409716 (PLCB1)
   04915 Estrogen signaling pathway
    100409716 (PLCB1)
   04921 Oxytocin signaling pathway
    100409716 (PLCB1)
   04926 Relaxin signaling pathway
    100409716 (PLCB1)
   04918 Thyroid hormone synthesis
    100409716 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100409716 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100409716 (PLCB1)
   04916 Melanogenesis
    100409716 (PLCB1)
   04924 Renin secretion
    100409716 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100409716 (PLCB1)
   04927 Cortisol synthesis and secretion
    100409716 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100409716 (PLCB1)
   04270 Vascular smooth muscle contraction
    100409716 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    100409716 (PLCB1)
   04971 Gastric acid secretion
    100409716 (PLCB1)
   04972 Pancreatic secretion
    100409716 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100409716 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100409716 (PLCB1)
   04725 Cholinergic synapse
    100409716 (PLCB1)
   04728 Dopaminergic synapse
    100409716 (PLCB1)
   04726 Serotonergic synapse
    100409716 (PLCB1)
   04720 Long-term potentiation
    100409716 (PLCB1)
   04730 Long-term depression
    100409716 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100409716 (PLCB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100409716 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100409716 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409716 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100409716 (PLCB1)
   05016 Huntington disease
    100409716 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100409716 (PLCB1)
   04934 Cushing syndrome
    100409716 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100409716 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100409716 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    100409716 (PLCB1)
   05143 African trypanosomiasis
    100409716 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100409716 (PLCB1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100409716 (PLCB1)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100409716 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100409716 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 100409716
NCBI-ProteinID: XP_008993982
Ensembl: ENSCJAG00000021317
UniProt: U3EKX0
Position
5
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKINEDSNHGSAPPSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgattcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaataaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggacgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtcaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctacactaaacttaag
ctgcaagtcactccagaagggcgtattcccctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagtcgaaactgctttagaggcttgtagtcttccgtcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatacctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacagcagcctcgccaaaaaaggacagatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaacgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaggcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggaatattgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactcgaatctggagttcctcttccaagtcctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagcgactcctccagtgtgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgatgatgatgacgacgatgactgt
aaaaaatcttcaatggatgaggggaccgctggaagcgaggctatggccacagaagaaatg
tctaacctggtgaactacattcagccggtcaagtttgagtcctttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaacttacc
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctattctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatgggcatgtat
gaatacaacgggaagagtggctacagattgaagccagaattcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtagcaaacactttatctgtt
aagattatttcaggtcagtttctttcggataagaaagttgggacttatgtggaagtagat
atgtttgggttgcctgtggatacaaggaggaaggcatttaagacgaagacatcccaagga
aatgctgtgaatcccgtctgggaagaagagcctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaatttattggccaccgt
atcttgccagtgcaagccattcgaccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcattgaagctttatcaaacccaatccgatatgtgaacctgatg
gagcagagagcaaagcagttggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggccgatcctggagaaacaccatcagaagctccaagtgaagcaaggacgactccagca
gaaaatggggtgaatcacactacatccctgacgcccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagagctaaagcaacagaaatcgtttgtg
aaacttcaaaagaagcactacaaggaaatgaaagacctggttaagaggcaccacaagaaa
accactgaccttatcaaagaacacactacaaagtataatgagattcagaatgactacttg
agaaggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcagaaccc
agcagccctgatcatggttcgtcaacaattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaattgacttgaaggacaaacagcagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgttgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaagagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgattcgg
tcatacatccaggaagtggtgcagtacatcaagaggttagaagaggcgcaaagcaaacgg
caagaaaaactcgtagagaaacacaaggagatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgccacttgag
attttggaattcgtgcaggaagccatgaaagggaagatcaatgaagacagcaatcacggt
tctgcccctccctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410075Help
Entry
100410075         CDS       T03264                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04062  Chemokine signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100410075 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100410075 (PLCB4)
   04310 Wnt signaling pathway
    100410075 (PLCB4)
   04371 Apelin signaling pathway
    100410075 (PLCB4)
   04020 Calcium signaling pathway
    100410075 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100410075 (PLCB4)
   04072 Phospholipase D signaling pathway
    100410075 (PLCB4)
   04071 Sphingolipid signaling pathway
    100410075 (PLCB4)
   04022 cGMP-PKG signaling pathway
    100410075 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100410075 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100410075 (PLCB4)
   04621 NOD-like receptor signaling pathway
    100410075 (PLCB4)
   04062 Chemokine signaling pathway
    100410075 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    100410075 (PLCB4)
   04922 Glucagon signaling pathway
    100410075 (PLCB4)
   04912 GnRH signaling pathway
    100410075 (PLCB4)
   04915 Estrogen signaling pathway
    100410075 (PLCB4)
   04921 Oxytocin signaling pathway
    100410075 (PLCB4)
   04926 Relaxin signaling pathway
    100410075 (PLCB4)
   04918 Thyroid hormone synthesis
    100410075 (PLCB4)
   04919 Thyroid hormone signaling pathway
    100410075 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    100410075 (PLCB4)
   04916 Melanogenesis
    100410075 (PLCB4)
   04924 Renin secretion
    100410075 (PLCB4)
   04925 Aldosterone synthesis and secretion
    100410075 (PLCB4)
   04927 Cortisol synthesis and secretion
    100410075 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100410075 (PLCB4)
   04270 Vascular smooth muscle contraction
    100410075 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    100410075 (PLCB4)
   04971 Gastric acid secretion
    100410075 (PLCB4)
   04972 Pancreatic secretion
    100410075 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100410075 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100410075 (PLCB4)
   04725 Cholinergic synapse
    100410075 (PLCB4)
   04728 Dopaminergic synapse
    100410075 (PLCB4)
   04726 Serotonergic synapse
    100410075 (PLCB4)
   04720 Long-term potentiation
    100410075 (PLCB4)
   04730 Long-term depression
    100410075 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    100410075 (PLCB4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100410075 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100410075 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410075 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100410075 (PLCB4)
   05016 Huntington disease
    100410075 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100410075 (PLCB4)
   04934 Cushing syndrome
    100410075 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100410075 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100410075 (PLCB4)
   05142 Chagas disease (American trypanosomiasis)
    100410075 (PLCB4)
   05143 African trypanosomiasis
    100410075 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100410075 (PLCB4)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100410075 (PLCB4)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100410075 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100410075 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6 TINF2_N EF-hand_7
Motif
Other DBs
NCBI-GeneID: 100410075
NCBI-ProteinID: XP_008993984
Ensembl: ENSCJAG00000021323
Position
5
AA seq 1017 aa AA seqDB search
MSGEKGTVKREVLNIIMAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEF
GFFLTWKSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGT
DLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKI
PVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIED
LFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIEMYEPDEDLKKR
GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVE
MYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPV
ILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKR
LKPEVEKKQLEALRSMMEAGEAASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADD
LGHKEAVANSVKKASDDLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYA
QPVKFQGFNVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSS
NYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSE
TPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY
NEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLP
TIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKN
DKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQIRIEDLKQMKAYLKHL
KKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKEGGK
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggggagaaggggacagtaaaaagggaggtcttgaatataatcatggccaaacct
tatgaatttaactggcagaaggaagttccttcctttttgcaagaaggagcagtttttgac
agatacgaagaggaatcctttgtgtttgaacccaactgcctcttcaaagtggatgagttt
ggcttctttctgacctggaaaagtgaaggcaaggaaggacaggtgctagaatgctccctc
atcaacagtattcggtcgggagccataccaaaggatcccaaaatcttggctgctcttgaa
gctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtctgcagtggcaca
gatctagtgaacattagctttacctacatggtggctgaaaatccagaagtaactaagcaa
tgggtagaaggcctgagatcaatcatacacaacttcagggccaacaacgtcagtccaatg
acgtgcctcaaaaaacactggatgaaattggcatttatgaccaacacaaatggtaaaatt
ccggttaggagtattactagaacctttgcatcgggaaaaacagaaaaagtgatctttcaa
gcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgagcctgcggcattt
acttatgaaaagttctatgaactgacacaaaagatttgtcctcggacagatatagaagat
cttttcaaaaaaatcaatggagacaaaactgattatttaacggtagaccaattagtgagc
tttctaaatgaacaccaacgagatcctcgattgaatgaaattttatttccattttatgat
accaaaagggcaatgcagatcattgagatgtatgaacctgatgaagatttgaagaaaaga
ggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaaaatgccccagtc
ttcctagatcgtttagaactttaccaagaaatggaccaccctctggctcactacttcatc
agttcttcccataacacttacctcactggcagacagttcggcgggaagtcttcagtagaa
atgtacagacaggttctcctggctggttgcagatgtgttgaacttgactgctgggatgga
aaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgtacagatatcctt
tttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatcagaatatcctgta
attctctcctttgaaaatcactgcagcaaatatcaacagtacaagatgtccaaatattgc
gaagatctatttggggatctcctgctgaaacaagcacttgaatcacatccactggaacca
ggcaggcctttgccatcccccaatgacctcaaaagaaaaatactcataaaaaacaagcgg
ctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatgatggaagctgga
gaagctgcctccccagcaaacatcttagaggatgataatgaagaggagatcgaaagtgct
gaccaagaagaggaagctcaccccgaattcaaatttggaaatgaactttctgctgatgac
ttgggtcacaaggaagctgttgcaaacagcgtcaagaaggcctcagatgaccttgaacat
gaaaacaacaaaaagggcctggtcactgtagaagatgagcaggcgtggatggcatcttat
aaatatgtaggtgctaccactaatatccatccatatttatccacaatgatcaactacgcc
cagcctgtaaagtttcaaggtttcaatgtggcagaagaacgcaatattcattacaacatg
tcttcttttaatgaatcagtcggtcttggctacttgaagacacacgcaattgaatttgtc
aattataacaaacggcaaatgagtcgcatttaccccaagggaggccgagtcgattccagt
aattacatgcctcagattttctggaacgctggctgccagatggtttcactgaactatcaa
accccagatttagcgatgcaattgaatcagggaaaattcgagtataatggatcatgcggg
taccttctcaaaccagatttcatgaggcggcctgatcgaacatttgatcccttctctgaa
actcctgttgatggcgttattgcagccacttgctcagtgcaggttatatcaggtcaattc
ttatcagataagaaaattggcacctacgtagaagtggatatgtatgggttgcccactgac
acgatacgtaaggaattccgaactcgcatggttatgaataatggactcaatccagtttac
aatgaagagtcatttgtatttcggaaggtgatcctgccggacctggctgtcttgagaata
gcagtgtatgatgataacaacaagctgattggccagaggatcctcccgcttgatggcctc
caagcagggtaccgacacatttcccttcgaaatgagggaaataaaccattatcactgcca
acaattttctgcaatattgttcttaaaacgtatgtgcctgatggatttggagatattgtg
gatgctctatcagatccaaagaaatttctctcaattacggaaaagagagcagaccaaatg
agagctatgggcattgaaaccagtgacatagccgatgtgcccagtgacacttccaaaaat
gacaagaaaggaaaggccaacaccgccaaagcaaatgtgacccctcagagtagctccgag
ctcagaccaaccacgacagctgccctggcttctggtgtggaagccaagaaaggtattgaa
cttatacctcaaataaggatagaagatttaaagcagatgaaggcttacttgaagcattta
aagaaacagcagaaggagctaaattctttaaagaagaaacatgcaaaggagcacagtacc
atgcagaagttacactgcacacaagttgacaaaattgtggcacagtatgacaaagagaag
tcgactcacgagaaaatcctagagaaggcaatgaagaaagaaggggggaaataa

DBGET integrated database retrieval system